Click here to enlarge.
PDB ID: 2myv
Entry in NMR Restraints Grid
Validation report in NRG-CING
Chem Shift validation: AVS_anomalous, AVS_full, LACS, SPARTA
BMRB Entry DOI: doi:10.13018/BMR25459
MolProbity Validation Chart
NMR-STAR file interactive viewer.
NMR-STAR v3 text file.
XML gzip file.
RDF gzip file.
All files associated with the entry
Citation: de Guillen, Karine; Ortiz-Vallejo, Diana; Gracy, Jerome; Fournier, Elisabeth; Kroj, Thomas; Padilla, Andre. "Structure analysis uncovers a highly diverse but structurally conserved effector family in phytopathogenic fungi" PLOS PATHOG. 11, e1005228-e1005228 (2015).
PubMed: 26506000
Assembly members:
AVR1-CO39, polymer, 98 residues, 9136.090 Da.
Natural source: Common Name: Rice blast fungus Taxonomy ID: 148305 Superkingdom: Eukaryota Kingdom: Fungi Genus/species: Magnaporthe grisea
Experimental source: Production method: recombinant technology Host organism: Escherichia coli Vector: pET-SP
Entity Sequences (FASTA):
AVR1-CO39: APQDNTSMGSSHHHHHHSSG
RENLYFQGHMAWKDCIIQRY
KDGDVNNIYTANRNEEITIE
EYKVFVNEACHPYPVILPDR
SVLSGDFTSAYADDDESC
Data type | Count |
13C chemical shifts | 238 |
15N chemical shifts | 86 |
1H chemical shifts | 493 |
Entity Assembly ID | Entity Name | Entity ID |
---|---|---|
1 | AVR1-CO39 | 1 |
Entity 1, AVR1-CO39 98 residues - 9136.090 Da.
the sequence "APQDNTSMGSSHHHHHHSSGRENLYFQGHM" is the His-TAG and the TEV cleavage site
1 | ALA | PRO | GLN | ASP | ASN | THR | SER | MET | GLY | SER | ||||
2 | SER | HIS | HIS | HIS | HIS | HIS | HIS | SER | SER | GLY | ||||
3 | ARG | GLU | ASN | LEU | TYR | PHE | GLN | GLY | HIS | MET | ||||
4 | ALA | TRP | LYS | ASP | CYS | ILE | ILE | GLN | ARG | TYR | ||||
5 | LYS | ASP | GLY | ASP | VAL | ASN | ASN | ILE | TYR | THR | ||||
6 | ALA | ASN | ARG | ASN | GLU | GLU | ILE | THR | ILE | GLU | ||||
7 | GLU | TYR | LYS | VAL | PHE | VAL | ASN | GLU | ALA | CYS | ||||
8 | HIS | PRO | TYR | PRO | VAL | ILE | LEU | PRO | ASP | ARG | ||||
9 | SER | VAL | LEU | SER | GLY | ASP | PHE | THR | SER | ALA | ||||
10 | TYR | ALA | ASP | ASP | ASP | GLU | SER | CYS |
Download HSQC peak lists in one of the following formats:
CSV: Backbone
or all simulated peaks
SPARKY: Backbone
or all simulated peaks