NMR Restraints Grid |
Result table
image | mrblock_id | pdb_id | bmrb_id | cing | stage | program | type |
582345 | 2mof | 19941 | cing | 2-parsed | STAR | comment |
data_2mof_MR_file_constraints save_Conversion_project _Study_list.Sf_category study_list _Study_list.Entry_ID parsed_2mof _Study_list.ID 1 loop_ _Study.ID _Study.Name _Study.Type _Study.Details _Study.Entry_ID _Study.Study_list_ID 1 "Conversion project" NMR . parsed_2mof 1 stop_ save_ save_entry_information _Entry.Sf_category entry_information _Entry.ID parsed_2mof _Entry.Title "Original constraint list(s)" _Entry.Version_type original _Entry.Submission_date . _Entry.Accession_date . _Entry.Last_release_date . _Entry.Original_release_date . _Entry.Origination . _Entry.NMR_STAR_version 3.1 _Entry.Original_NMR_STAR_version . _Entry.Experimental_method NMR _Entry.Experimental_method_subtype . loop_ _Related_entries.Database_name _Related_entries.Database_accession_code _Related_entries.Relationship _Related_entries.Entry_ID PDB 2mof "Master copy" parsed_2mof stop_ save_ save_global_Org_file_characteristics _Constraint_stat_list.Sf_category constraint_statistics _Constraint_stat_list.Entry_ID parsed_2mof _Constraint_stat_list.ID 1 loop_ _Constraint_file.ID _Constraint_file.Constraint_filename _Constraint_file.Software_ID _Constraint_file.Software_label _Constraint_file.Software_name _Constraint_file.Block_ID _Constraint_file.Constraint_type _Constraint_file.Constraint_subtype _Constraint_file.Constraint_subsubtype _Constraint_file.Constraint_number _Constraint_file.Entry_ID _Constraint_file.Constraint_stat_list_ID 1 2mof.mr . . "MR format" 1 comment "Not applicable" "Not applicable" 0 parsed_2mof 1 1 2mof.mr . . XPLOR/CNS 2 "dihedral angle" "Not applicable" "Not applicable" 0 parsed_2mof 1 1 2mof.mr . . XPLOR/CNS 3 distance NOE ambi 0 parsed_2mof 1 1 2mof.mr . . XPLOR/CNS 4 distance "hydrogen bond" simple 0 parsed_2mof 1 1 2mof.mr . . "MR format" 5 "nomenclature mapping" "Not applicable" "Not applicable" 0 parsed_2mof 1 stop_ save_ save_MR_file_comment_1 _Org_constr_file_comment.Sf_category org_constr_file_comment _Org_constr_file_comment.Entry_ID parsed_2mof _Org_constr_file_comment.ID 1 _Org_constr_file_comment.Constraint_file_ID 1 _Org_constr_file_comment.Block_ID 1 _Org_constr_file_comment.Details "Generated by Wattos" _Org_constr_file_comment.Comment ; *HEADER MEMBRANE PROTEIN 25-APR-14 2MOF *TITLE STRUCTURAL INSIGHTS OF TM DOMAIN OF LAMP-2A IN DPC MICELLES *COMPND MOL_ID: 1; *COMPND 2 MOLECULE: LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 2; *COMPND 3 CHAIN: A; *COMPND 4 FRAGMENT: UNP RESIDUES 369-410; *COMPND 5 SYNONYM: LAMP-2, LYSOSOME-ASSOCIATED MEMBRANE PROTEIN 2, CD107 *COMPND 6 ANTIGEN-LIKE FAMILY MEMBER B; *COMPND 7 ENGINEERED: YES *SOURCE MOL_ID: 1; *SOURCE 2 ORGANISM_SCIENTIFIC: HOMO SAPIENS; *SOURCE 3 ORGANISM_COMMON: HUMAN; *SOURCE 4 ORGANISM_TAXID: 9606; *SOURCE 5 GENE: LAMP2; *SOURCE 6 EXPRESSION_SYSTEM: ESCHERICHIA COLI; *SOURCE 7 EXPRESSION_SYSTEM_TAXID: 562; *SOURCE 8 EXPRESSION_SYSTEM_VECTOR: PMAL2PX *KEYWDS MEMBRANE PROTEIN *EXPDTA SOLUTION NMR *NUMMDL 20 *AUTHOR N.TJANDRA, A.ROUT *REVDAT 1 29-OCT-14 2MOF 0 All constraints used for the structure calculation of Transmembrane domain (TM) of LAMP-2A monomer #Amino Acid Sequence SADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF ; save_
Contact the webmaster for help, if required. Sunday, May 19, 2024 8:12:22 AM GMT (wattos1)