data_52628
#######################
# Entry information #
#######################
save_entry_information_1
_Entry.Sf_category entry_information
_Entry.Sf_framecode entry_information_1
_Entry.ID 52628
_Entry.Title
;
p14ARF forms meso-scale assemblies upon phase separation with NPM1
;
_Entry.Type macromolecule
_Entry.Version_type original
_Entry.Submission_date 2024-10-04
_Entry.Accession_date 2024-10-04
_Entry.Last_release_date 2024-10-04
_Entry.Original_release_date 2024-10-04
_Entry.Origination author
_Entry.Format_name .
_Entry.NMR_STAR_version 3.2.14.0
_Entry.NMR_STAR_dict_location .
_Entry.Original_NMR_STAR_version 3.1
_Entry.Experimental_method NMR
_Entry.Experimental_method_subtype solid-state
_Entry.Source_data_format .
_Entry.Source_data_format_version .
_Entry.Generated_software_name .
_Entry.Generated_software_version .
_Entry.Generated_software_ID 1
_Entry.Generated_software_label $software_1
_Entry.Generated_date .
_Entry.DOI .
_Entry.UUID .
_Entry.Related_coordinate_file_name .
_Entry.Details .
_Entry.BMRB_internal_directory_name .
loop_
_Entry_author.Ordinal
_Entry_author.Given_name
_Entry_author.Family_name
_Entry_author.First_initial
_Entry_author.Middle_initials
_Entry_author.Family_title
_Entry_author.ORCID
_Entry_author.Entry_ID
1 Eric Gibbs . . . 0000-0002-7210-7216 52628
2 Richard Kriwacki . . . . 52628
stop_
loop_
_Data_set.Type
_Data_set.Count
_Data_set.Entry_ID
assigned_chemical_shifts 2 52628
stop_
loop_
_Datum.Type
_Datum.Count
_Datum.Entry_ID
'13C chemical shifts' 109 52628
'15N chemical shifts' 12 52628
stop_
loop_
_Release.Release_number
_Release.Format_type
_Release.Format_version
_Release.Date
_Release.Submission_date
_Release.Type
_Release.Author
_Release.Detail
_Release.Entry_ID
1 . . 2025-01-09 . original BMRB . 52628
stop_
loop_
_Related_entries.Database_name
_Related_entries.Database_accession_code
_Related_entries.Relationship
_Related_entries.Entry_ID
BMRB 52629 'phase separated p14ARF-NPM1-IDR condensate, ARF solution assignment' 52628
BMRB 52630 'phase separated p14ARF-NPM1 condensate, NPM1 solution assignment' 52628
stop_
save_
###############
# Citations #
###############
save_citations_1
_Citation.Sf_category citations
_Citation.Sf_framecode citations_1
_Citation.Entry_ID 52628
_Citation.ID 1
_Citation.Name .
_Citation.Class 'entry citation'
_Citation.CAS_abstract_code .
_Citation.MEDLINE_UI_code .
_Citation.PubMed_ID 39528457
_Citation.DOI .
_Citation.Full_citation .
_Citation.Title
;
p14ARF forms meso-scale assemblies upon phase separation with NPM1
;
_Citation.Status published
_Citation.Type journal
_Citation.Journal_abbrev 'Nat. Commun.'
_Citation.Journal_name_full 'Nature Communications'
_Citation.Journal_volume 15
_Citation.Journal_issue 1
_Citation.Journal_ASTM .
_Citation.Journal_ISSN 2041-1723
_Citation.Journal_CSD .
_Citation.Book_title .
_Citation.Book_chapter_title .
_Citation.Book_volume .
_Citation.Book_series .
_Citation.Book_publisher .
_Citation.Book_publisher_city .
_Citation.Book_ISBN .
_Citation.Conference_title .
_Citation.Conference_site .
_Citation.Conference_state_province .
_Citation.Conference_country .
_Citation.Conference_start_date .
_Citation.Conference_end_date .
_Citation.Conference_abstract_number .
_Citation.Thesis_institution .
_Citation.Thesis_institution_city .
_Citation.Thesis_institution_country .
_Citation.WWW_URL .
_Citation.Page_first 9531
_Citation.Page_last 9531
_Citation.Year 2024
_Citation.Details .
loop_
_Citation_author.Ordinal
_Citation_author.Given_name
_Citation_author.Family_name
_Citation_author.First_initial
_Citation_author.Middle_initials
_Citation_author.Family_title
_Citation_author.ORCID
_Citation_author.Entry_ID
_Citation_author.Citation_ID
1 Eric Gibbs . . . . 52628 1
2 Qi Miao . . . . 52628 1
3 Mylene Ferrolino . . . . 52628 1
4 Richa Bajpai . . . . 52628 1
5 Aila Hassan . . . . 52628 1
6 Aaron Phillips . . . . 52628 1
7 Aaron Pitre . . . . 52628 1
8 Rainer Kummerle . . . . 52628 1
9 Shondra Miller . . . . 52628 1
10 Gergely Nagy . . . . 52628 1
11 Wellington Leite . . . . 52628 1
12 William Heller . . . . 52628 1
13 Chris Stanley . . . . 52628 1
14 Barbara Perrone . . . . 52628 1
15 Richard Kriwacki . . . . 52628 1
stop_
save_
#############################################
# Molecular system (assembly) description #
#############################################
save_assembly_1
_Assembly.Sf_category assembly
_Assembly.Sf_framecode assembly_1
_Assembly.Entry_ID 52628
_Assembly.ID 1
_Assembly.Name 'phase separated p14ARF-NPM1 meso-scale assembly'
_Assembly.BMRB_code .
_Assembly.Number_of_components 3
_Assembly.Organic_ligands 0
_Assembly.Metal_ions 0
_Assembly.Non_standard_bonds no
_Assembly.Ambiguous_conformational_states yes
_Assembly.Ambiguous_chem_comp_sites .
_Assembly.Molecules_in_chemical_exchange no
_Assembly.Paramagnetic no
_Assembly.Thiol_state .
_Assembly.Molecular_mass .
_Assembly.Enzyme_commission_number .
_Assembly.Details .
_Assembly.DB_query_date .
_Assembly.DB_query_revised_last_date .
loop_
_Entity_assembly.ID
_Entity_assembly.Entity_assembly_name
_Entity_assembly.Entity_ID
_Entity_assembly.Entity_label
_Entity_assembly.Asym_ID
_Entity_assembly.PDB_chain_ID
_Entity_assembly.Experimental_data_reported
_Entity_assembly.Physical_state
_Entity_assembly.Conformational_isomer
_Entity_assembly.Chemical_exchange_state
_Entity_assembly.Magnetic_equivalence_group_code
_Entity_assembly.Role
_Entity_assembly.Details
_Entity_assembly.Entry_ID
_Entity_assembly.Assembly_ID
1 'p14ARF (state 1)' 1 $entity_1 . . yes native yes yes . 'p14ARF (state 1)' 'open conformation' 52628 1
2 'p14ARF (state 2)' 1 $entity_1 . . yes native yes yes . 'p14ARF (state 2)' 'closed conformation' 52628 1
3 NPM1 2 $entity_2 . . no native no no . . . 52628 1
stop_
save_
####################################
# Biological polymers and ligands #
####################################
save_entity_1
_Entity.Sf_category entity
_Entity.Sf_framecode entity_1
_Entity.Entry_ID 52628
_Entity.ID 1
_Entity.BMRB_code .
_Entity.Name entity_1
_Entity.Type polymer
_Entity.Polymer_common_type .
_Entity.Polymer_type polypeptide(L)
_Entity.Polymer_type_details .
_Entity.Polymer_strand_ID .
_Entity.Polymer_seq_one_letter_code_can .
_Entity.Polymer_seq_one_letter_code
;
MGSSHHHHHHSQDLENLYFQ
GSMVRRFLVTLRIRRACGPP
RVRVFVVHIPRLTGEWAAPG
APAAVALVLMLLRSQRLGQQ
PLPRRPGHDDGQRPSGGAAA
APRRGAQLRRPRHSHPTRAR
RCPGGLPGHAGGAAPGRGAA
GRARCLGPSARGPG
;
_Entity.Target_identifier .
_Entity.Polymer_author_defined_seq
;
MVRRFLVTLRIRRACGPPRV
RVFVVHIPRLTGEWAAPGAP
AAVALVLMLLRSQRLGQQPL
PRRPGHDDGQRPSGGAAAAP
RRGAQLRRPRHSHPTRARRC
PGGLPGHAGGAAPGRGAAGR
ARCLGPSARGPG
;
_Entity.Polymer_author_seq_details .
_Entity.Ambiguous_conformational_states yes
_Entity.Ambiguous_chem_comp_sites yes
_Entity.Nstd_monomer no
_Entity.Nstd_chirality no
_Entity.Nstd_linkage no
_Entity.Nonpolymer_comp_ID .
_Entity.Nonpolymer_comp_label .
_Entity.Number_of_monomers 154
_Entity.Number_of_nonpolymer_components .
_Entity.Paramagnetic no
_Entity.Thiol_state 'all free'
_Entity.Src_method .
_Entity.Parent_entity_ID 1
_Entity.Fragment .
_Entity.Mutation .
_Entity.EC_number .
_Entity.Calc_isoelectric_point .
_Entity.Formula_weight .
_Entity.Formula_weight_exptl .
_Entity.Formula_weight_exptl_meth .
_Entity.Details .
_Entity.DB_query_date .
_Entity.DB_query_revised_last_date .
loop_
_Entity_comp_index.ID
_Entity_comp_index.Auth_seq_ID
_Entity_comp_index.Comp_ID
_Entity_comp_index.Comp_label
_Entity_comp_index.Entry_ID
_Entity_comp_index.Entity_ID
1 -21 MET . 52628 1
2 -20 GLY . 52628 1
3 -19 SER . 52628 1
4 -18 SER . 52628 1
5 -17 HIS . 52628 1
6 -16 HIS . 52628 1
7 -15 HIS . 52628 1
8 -14 HIS . 52628 1
9 -13 HIS . 52628 1
10 -12 HIS . 52628 1
11 -11 SER . 52628 1
12 -10 GLN . 52628 1
13 -9 ASP . 52628 1
14 -8 LEU . 52628 1
15 -7 GLU . 52628 1
16 -6 ASN . 52628 1
17 -5 LEU . 52628 1
18 -4 TYR . 52628 1
19 -3 PHE . 52628 1
20 -2 GLN . 52628 1
21 -1 GLY . 52628 1
22 0 SER . 52628 1
23 1 MET . 52628 1
24 2 VAL . 52628 1
25 3 ARG . 52628 1
26 4 ARG . 52628 1
27 5 PHE . 52628 1
28 6 LEU . 52628 1
29 7 VAL . 52628 1
30 8 THR . 52628 1
31 9 LEU . 52628 1
32 10 ARG . 52628 1
33 11 ILE . 52628 1
34 12 ARG . 52628 1
35 13 ARG . 52628 1
36 14 ALA . 52628 1
37 15 CYS . 52628 1
38 16 GLY . 52628 1
39 17 PRO . 52628 1
40 18 PRO . 52628 1
41 19 ARG . 52628 1
42 20 VAL . 52628 1
43 21 ARG . 52628 1
44 22 VAL . 52628 1
45 23 PHE . 52628 1
46 24 VAL . 52628 1
47 25 VAL . 52628 1
48 26 HIS . 52628 1
49 27 ILE . 52628 1
50 28 PRO . 52628 1
51 29 ARG . 52628 1
52 30 LEU . 52628 1
53 31 THR . 52628 1
54 32 GLY . 52628 1
55 33 GLU . 52628 1
56 34 TRP . 52628 1
57 35 ALA . 52628 1
58 36 ALA . 52628 1
59 37 PRO . 52628 1
60 38 GLY . 52628 1
61 39 ALA . 52628 1
62 40 PRO . 52628 1
63 41 ALA . 52628 1
64 42 ALA . 52628 1
65 43 VAL . 52628 1
66 44 ALA . 52628 1
67 45 LEU . 52628 1
68 46 VAL . 52628 1
69 47 LEU . 52628 1
70 48 MET . 52628 1
71 49 LEU . 52628 1
72 50 LEU . 52628 1
73 51 ARG . 52628 1
74 52 SER . 52628 1
75 53 GLN . 52628 1
76 54 ARG . 52628 1
77 55 LEU . 52628 1
78 56 GLY . 52628 1
79 57 GLN . 52628 1
80 58 GLN . 52628 1
81 59 PRO . 52628 1
82 60 LEU . 52628 1
83 61 PRO . 52628 1
84 62 ARG . 52628 1
85 63 ARG . 52628 1
86 64 PRO . 52628 1
87 65 GLY . 52628 1
88 66 HIS . 52628 1
89 67 ASP . 52628 1
90 68 ASP . 52628 1
91 69 GLY . 52628 1
92 70 GLN . 52628 1
93 71 ARG . 52628 1
94 72 PRO . 52628 1
95 73 SER . 52628 1
96 74 GLY . 52628 1
97 75 GLY . 52628 1
98 76 ALA . 52628 1
99 77 ALA . 52628 1
100 78 ALA . 52628 1
101 79 ALA . 52628 1
102 80 PRO . 52628 1
103 81 ARG . 52628 1
104 82 ARG . 52628 1
105 83 GLY . 52628 1
106 84 ALA . 52628 1
107 85 GLN . 52628 1
108 86 LEU . 52628 1
109 87 ARG . 52628 1
110 88 ARG . 52628 1
111 89 PRO . 52628 1
112 90 ARG . 52628 1
113 91 HIS . 52628 1
114 92 SER . 52628 1
115 93 HIS . 52628 1
116 94 PRO . 52628 1
117 95 THR . 52628 1
118 96 ARG . 52628 1
119 97 ALA . 52628 1
120 98 ARG . 52628 1
121 99 ARG . 52628 1
122 100 CYS . 52628 1
123 101 PRO . 52628 1
124 102 GLY . 52628 1
125 103 GLY . 52628 1
126 104 LEU . 52628 1
127 105 PRO . 52628 1
128 106 GLY . 52628 1
129 107 HIS . 52628 1
130 108 ALA . 52628 1
131 109 GLY . 52628 1
132 110 GLY . 52628 1
133 111 ALA . 52628 1
134 112 ALA . 52628 1
135 113 PRO . 52628 1
136 114 GLY . 52628 1
137 115 ARG . 52628 1
138 116 GLY . 52628 1
139 117 ALA . 52628 1
140 118 ALA . 52628 1
141 119 GLY . 52628 1
142 120 ARG . 52628 1
143 121 ALA . 52628 1
144 122 ARG . 52628 1
145 123 CYS . 52628 1
146 124 LEU . 52628 1
147 125 GLY . 52628 1
148 126 PRO . 52628 1
149 127 SER . 52628 1
150 128 ALA . 52628 1
151 129 ARG . 52628 1
152 130 GLY . 52628 1
153 131 PRO . 52628 1
154 132 GLY . 52628 1
stop_
loop_
_Entity_poly_seq.Hetero
_Entity_poly_seq.Mon_ID
_Entity_poly_seq.Num
_Entity_poly_seq.Comp_index_ID
_Entity_poly_seq.Entry_ID
_Entity_poly_seq.Entity_ID
. MET 1 1 52628 1
. GLY 2 2 52628 1
. SER 3 3 52628 1
. SER 4 4 52628 1
. HIS 5 5 52628 1
. HIS 6 6 52628 1
. HIS 7 7 52628 1
. HIS 8 8 52628 1
. HIS 9 9 52628 1
. HIS 10 10 52628 1
. SER 11 11 52628 1
. GLN 12 12 52628 1
. ASP 13 13 52628 1
. LEU 14 14 52628 1
. GLU 15 15 52628 1
. ASN 16 16 52628 1
. LEU 17 17 52628 1
. TYR 18 18 52628 1
. PHE 19 19 52628 1
. GLN 20 20 52628 1
. GLY 21 21 52628 1
. SER 22 22 52628 1
. MET 23 23 52628 1
. VAL 24 24 52628 1
. ARG 25 25 52628 1
. ARG 26 26 52628 1
. PHE 27 27 52628 1
. LEU 28 28 52628 1
. VAL 29 29 52628 1
. THR 30 30 52628 1
. LEU 31 31 52628 1
. ARG 32 32 52628 1
. ILE 33 33 52628 1
. ARG 34 34 52628 1
. ARG 35 35 52628 1
. ALA 36 36 52628 1
. CYS 37 37 52628 1
. GLY 38 38 52628 1
. PRO 39 39 52628 1
. PRO 40 40 52628 1
. ARG 41 41 52628 1
. VAL 42 42 52628 1
. ARG 43 43 52628 1
. VAL 44 44 52628 1
. PHE 45 45 52628 1
. VAL 46 46 52628 1
. VAL 47 47 52628 1
. HIS 48 48 52628 1
. ILE 49 49 52628 1
. PRO 50 50 52628 1
. ARG 51 51 52628 1
. LEU 52 52 52628 1
. THR 53 53 52628 1
. GLY 54 54 52628 1
. GLU 55 55 52628 1
. TRP 56 56 52628 1
. ALA 57 57 52628 1
. ALA 58 58 52628 1
. PRO 59 59 52628 1
. GLY 60 60 52628 1
. ALA 61 61 52628 1
. PRO 62 62 52628 1
. ALA 63 63 52628 1
. ALA 64 64 52628 1
. VAL 65 65 52628 1
. ALA 66 66 52628 1
. LEU 67 67 52628 1
. VAL 68 68 52628 1
. LEU 69 69 52628 1
. MET 70 70 52628 1
. LEU 71 71 52628 1
. LEU 72 72 52628 1
. ARG 73 73 52628 1
. SER 74 74 52628 1
. GLN 75 75 52628 1
. ARG 76 76 52628 1
. LEU 77 77 52628 1
. GLY 78 78 52628 1
. GLN 79 79 52628 1
. GLN 80 80 52628 1
. PRO 81 81 52628 1
. LEU 82 82 52628 1
. PRO 83 83 52628 1
. ARG 84 84 52628 1
. ARG 85 85 52628 1
. PRO 86 86 52628 1
. GLY 87 87 52628 1
. HIS 88 88 52628 1
. ASP 89 89 52628 1
. ASP 90 90 52628 1
. GLY 91 91 52628 1
. GLN 92 92 52628 1
. ARG 93 93 52628 1
. PRO 94 94 52628 1
. SER 95 95 52628 1
. GLY 96 96 52628 1
. GLY 97 97 52628 1
. ALA 98 98 52628 1
. ALA 99 99 52628 1
. ALA 100 100 52628 1
. ALA 101 101 52628 1
. PRO 102 102 52628 1
. ARG 103 103 52628 1
. ARG 104 104 52628 1
. GLY 105 105 52628 1
. ALA 106 106 52628 1
. GLN 107 107 52628 1
. LEU 108 108 52628 1
. ARG 109 109 52628 1
. ARG 110 110 52628 1
. PRO 111 111 52628 1
. ARG 112 112 52628 1
. HIS 113 113 52628 1
. SER 114 114 52628 1
. HIS 115 115 52628 1
. PRO 116 116 52628 1
. THR 117 117 52628 1
. ARG 118 118 52628 1
. ALA 119 119 52628 1
. ARG 120 120 52628 1
. ARG 121 121 52628 1
. CYS 122 122 52628 1
. PRO 123 123 52628 1
. GLY 124 124 52628 1
. GLY 125 125 52628 1
. LEU 126 126 52628 1
. PRO 127 127 52628 1
. GLY 128 128 52628 1
. HIS 129 129 52628 1
. ALA 130 130 52628 1
. GLY 131 131 52628 1
. GLY 132 132 52628 1
. ALA 133 133 52628 1
. ALA 134 134 52628 1
. PRO 135 135 52628 1
. GLY 136 136 52628 1
. ARG 137 137 52628 1
. GLY 138 138 52628 1
. ALA 139 139 52628 1
. ALA 140 140 52628 1
. GLY 141 141 52628 1
. ARG 142 142 52628 1
. ALA 143 143 52628 1
. ARG 144 144 52628 1
. CYS 145 145 52628 1
. LEU 146 146 52628 1
. GLY 147 147 52628 1
. PRO 148 148 52628 1
. SER 149 149 52628 1
. ALA 150 150 52628 1
. ARG 151 151 52628 1
. GLY 152 152 52628 1
. PRO 153 153 52628 1
. GLY 154 154 52628 1
stop_
save_
save_entity_2
_Entity.Sf_category entity
_Entity.Sf_framecode entity_2
_Entity.Entry_ID 52628
_Entity.ID 2
_Entity.BMRB_code .
_Entity.Name entity_2
_Entity.Type polymer
_Entity.Polymer_common_type .
_Entity.Polymer_type polypeptide(L)
_Entity.Polymer_type_details .
_Entity.Polymer_strand_ID .
_Entity.Polymer_seq_one_letter_code_can .
_Entity.Polymer_seq_one_letter_code
;
MEDSMDMDMSPLRPQNYLFG
CELKADKDYHFKVDNDENEH
QLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLK
MSVQPTVSLGGFEITPPVVL
RLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISG
KRSAPGGGSKVPQKKVKLAA
DEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTP
AKNAQKSNQNGKDSKPSSTP
RSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGS
LPKVEAKFINYVKNCFRMTD
QEAIQDLWQWRKSL
;
_Entity.Target_identifier .
_Entity.Polymer_author_defined_seq
;
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
;
_Entity.Polymer_author_seq_details .
_Entity.Ambiguous_conformational_states yes
_Entity.Ambiguous_chem_comp_sites no
_Entity.Nstd_monomer no
_Entity.Nstd_chirality no
_Entity.Nstd_linkage no
_Entity.Nonpolymer_comp_ID .
_Entity.Nonpolymer_comp_label .
_Entity.Number_of_monomers 294
_Entity.Number_of_nonpolymer_components .
_Entity.Paramagnetic no
_Entity.Thiol_state 'all free'
_Entity.Src_method .
_Entity.Parent_entity_ID 2
_Entity.Fragment .
_Entity.Mutation .
_Entity.EC_number .
_Entity.Calc_isoelectric_point .
_Entity.Formula_weight .
_Entity.Formula_weight_exptl .
_Entity.Formula_weight_exptl_meth .
_Entity.Details .
_Entity.DB_query_date .
_Entity.DB_query_revised_last_date .
loop_
_Entity_comp_index.ID
_Entity_comp_index.Auth_seq_ID
_Entity_comp_index.Comp_ID
_Entity_comp_index.Comp_label
_Entity_comp_index.Entry_ID
_Entity_comp_index.Entity_ID
1 . MET . 52628 2
2 . GLU . 52628 2
3 . ASP . 52628 2
4 . SER . 52628 2
5 . MET . 52628 2
6 . ASP . 52628 2
7 . MET . 52628 2
8 . ASP . 52628 2
9 . MET . 52628 2
10 . SER . 52628 2
11 . PRO . 52628 2
12 . LEU . 52628 2
13 . ARG . 52628 2
14 . PRO . 52628 2
15 . GLN . 52628 2
16 . ASN . 52628 2
17 . TYR . 52628 2
18 . LEU . 52628 2
19 . PHE . 52628 2
20 . GLY . 52628 2
21 . CYS . 52628 2
22 . GLU . 52628 2
23 . LEU . 52628 2
24 . LYS . 52628 2
25 . ALA . 52628 2
26 . ASP . 52628 2
27 . LYS . 52628 2
28 . ASP . 52628 2
29 . TYR . 52628 2
30 . HIS . 52628 2
31 . PHE . 52628 2
32 . LYS . 52628 2
33 . VAL . 52628 2
34 . ASP . 52628 2
35 . ASN . 52628 2
36 . ASP . 52628 2
37 . GLU . 52628 2
38 . ASN . 52628 2
39 . GLU . 52628 2
40 . HIS . 52628 2
41 . GLN . 52628 2
42 . LEU . 52628 2
43 . SER . 52628 2
44 . LEU . 52628 2
45 . ARG . 52628 2
46 . THR . 52628 2
47 . VAL . 52628 2
48 . SER . 52628 2
49 . LEU . 52628 2
50 . GLY . 52628 2
51 . ALA . 52628 2
52 . GLY . 52628 2
53 . ALA . 52628 2
54 . LYS . 52628 2
55 . ASP . 52628 2
56 . GLU . 52628 2
57 . LEU . 52628 2
58 . HIS . 52628 2
59 . ILE . 52628 2
60 . VAL . 52628 2
61 . GLU . 52628 2
62 . ALA . 52628 2
63 . GLU . 52628 2
64 . ALA . 52628 2
65 . MET . 52628 2
66 . ASN . 52628 2
67 . TYR . 52628 2
68 . GLU . 52628 2
69 . GLY . 52628 2
70 . SER . 52628 2
71 . PRO . 52628 2
72 . ILE . 52628 2
73 . LYS . 52628 2
74 . VAL . 52628 2
75 . THR . 52628 2
76 . LEU . 52628 2
77 . ALA . 52628 2
78 . THR . 52628 2
79 . LEU . 52628 2
80 . LYS . 52628 2
81 . MET . 52628 2
82 . SER . 52628 2
83 . VAL . 52628 2
84 . GLN . 52628 2
85 . PRO . 52628 2
86 . THR . 52628 2
87 . VAL . 52628 2
88 . SER . 52628 2
89 . LEU . 52628 2
90 . GLY . 52628 2
91 . GLY . 52628 2
92 . PHE . 52628 2
93 . GLU . 52628 2
94 . ILE . 52628 2
95 . THR . 52628 2
96 . PRO . 52628 2
97 . PRO . 52628 2
98 . VAL . 52628 2
99 . VAL . 52628 2
100 . LEU . 52628 2
101 . ARG . 52628 2
102 . LEU . 52628 2
103 . LYS . 52628 2
104 . CYS . 52628 2
105 . GLY . 52628 2
106 . SER . 52628 2
107 . GLY . 52628 2
108 . PRO . 52628 2
109 . VAL . 52628 2
110 . HIS . 52628 2
111 . ILE . 52628 2
112 . SER . 52628 2
113 . GLY . 52628 2
114 . GLN . 52628 2
115 . HIS . 52628 2
116 . LEU . 52628 2
117 . VAL . 52628 2
118 . ALA . 52628 2
119 . VAL . 52628 2
120 . GLU . 52628 2
121 . GLU . 52628 2
122 . ASP . 52628 2
123 . ALA . 52628 2
124 . GLU . 52628 2
125 . SER . 52628 2
126 . GLU . 52628 2
127 . ASP . 52628 2
128 . GLU . 52628 2
129 . GLU . 52628 2
130 . GLU . 52628 2
131 . GLU . 52628 2
132 . ASP . 52628 2
133 . VAL . 52628 2
134 . LYS . 52628 2
135 . LEU . 52628 2
136 . LEU . 52628 2
137 . SER . 52628 2
138 . ILE . 52628 2
139 . SER . 52628 2
140 . GLY . 52628 2
141 . LYS . 52628 2
142 . ARG . 52628 2
143 . SER . 52628 2
144 . ALA . 52628 2
145 . PRO . 52628 2
146 . GLY . 52628 2
147 . GLY . 52628 2
148 . GLY . 52628 2
149 . SER . 52628 2
150 . LYS . 52628 2
151 . VAL . 52628 2
152 . PRO . 52628 2
153 . GLN . 52628 2
154 . LYS . 52628 2
155 . LYS . 52628 2
156 . VAL . 52628 2
157 . LYS . 52628 2
158 . LEU . 52628 2
159 . ALA . 52628 2
160 . ALA . 52628 2
161 . ASP . 52628 2
162 . GLU . 52628 2
163 . ASP . 52628 2
164 . ASP . 52628 2
165 . ASP . 52628 2
166 . ASP . 52628 2
167 . ASP . 52628 2
168 . ASP . 52628 2
169 . GLU . 52628 2
170 . GLU . 52628 2
171 . ASP . 52628 2
172 . ASP . 52628 2
173 . ASP . 52628 2
174 . GLU . 52628 2
175 . ASP . 52628 2
176 . ASP . 52628 2
177 . ASP . 52628 2
178 . ASP . 52628 2
179 . ASP . 52628 2
180 . ASP . 52628 2
181 . PHE . 52628 2
182 . ASP . 52628 2
183 . ASP . 52628 2
184 . GLU . 52628 2
185 . GLU . 52628 2
186 . ALA . 52628 2
187 . GLU . 52628 2
188 . GLU . 52628 2
189 . LYS . 52628 2
190 . ALA . 52628 2
191 . PRO . 52628 2
192 . VAL . 52628 2
193 . LYS . 52628 2
194 . LYS . 52628 2
195 . SER . 52628 2
196 . ILE . 52628 2
197 . ARG . 52628 2
198 . ASP . 52628 2
199 . THR . 52628 2
200 . PRO . 52628 2
201 . ALA . 52628 2
202 . LYS . 52628 2
203 . ASN . 52628 2
204 . ALA . 52628 2
205 . GLN . 52628 2
206 . LYS . 52628 2
207 . SER . 52628 2
208 . ASN . 52628 2
209 . GLN . 52628 2
210 . ASN . 52628 2
211 . GLY . 52628 2
212 . LYS . 52628 2
213 . ASP . 52628 2
214 . SER . 52628 2
215 . LYS . 52628 2
216 . PRO . 52628 2
217 . SER . 52628 2
218 . SER . 52628 2
219 . THR . 52628 2
220 . PRO . 52628 2
221 . ARG . 52628 2
222 . SER . 52628 2
223 . LYS . 52628 2
224 . GLY . 52628 2
225 . GLN . 52628 2
226 . GLU . 52628 2
227 . SER . 52628 2
228 . PHE . 52628 2
229 . LYS . 52628 2
230 . LYS . 52628 2
231 . GLN . 52628 2
232 . GLU . 52628 2
233 . LYS . 52628 2
234 . THR . 52628 2
235 . PRO . 52628 2
236 . LYS . 52628 2
237 . THR . 52628 2
238 . PRO . 52628 2
239 . LYS . 52628 2
240 . GLY . 52628 2
241 . PRO . 52628 2
242 . SER . 52628 2
243 . SER . 52628 2
244 . VAL . 52628 2
245 . GLU . 52628 2
246 . ASP . 52628 2
247 . ILE . 52628 2
248 . LYS . 52628 2
249 . ALA . 52628 2
250 . LYS . 52628 2
251 . MET . 52628 2
252 . GLN . 52628 2
253 . ALA . 52628 2
254 . SER . 52628 2
255 . ILE . 52628 2
256 . GLU . 52628 2
257 . LYS . 52628 2
258 . GLY . 52628 2
259 . GLY . 52628 2
260 . SER . 52628 2
261 . LEU . 52628 2
262 . PRO . 52628 2
263 . LYS . 52628 2
264 . VAL . 52628 2
265 . GLU . 52628 2
266 . ALA . 52628 2
267 . LYS . 52628 2
268 . PHE . 52628 2
269 . ILE . 52628 2
270 . ASN . 52628 2
271 . TYR . 52628 2
272 . VAL . 52628 2
273 . LYS . 52628 2
274 . ASN . 52628 2
275 . CYS . 52628 2
276 . PHE . 52628 2
277 . ARG . 52628 2
278 . MET . 52628 2
279 . THR . 52628 2
280 . ASP . 52628 2
281 . GLN . 52628 2
282 . GLU . 52628 2
283 . ALA . 52628 2
284 . ILE . 52628 2
285 . GLN . 52628 2
286 . ASP . 52628 2
287 . LEU . 52628 2
288 . TRP . 52628 2
289 . GLN . 52628 2
290 . TRP . 52628 2
291 . ARG . 52628 2
292 . LYS . 52628 2
293 . SER . 52628 2
294 . LEU . 52628 2
stop_
loop_
_Entity_poly_seq.Hetero
_Entity_poly_seq.Mon_ID
_Entity_poly_seq.Num
_Entity_poly_seq.Comp_index_ID
_Entity_poly_seq.Entry_ID
_Entity_poly_seq.Entity_ID
. MET 1 1 52628 2
. GLU 2 2 52628 2
. ASP 3 3 52628 2
. SER 4 4 52628 2
. MET 5 5 52628 2
. ASP 6 6 52628 2
. MET 7 7 52628 2
. ASP 8 8 52628 2
. MET 9 9 52628 2
. SER 10 10 52628 2
. PRO 11 11 52628 2
. LEU 12 12 52628 2
. ARG 13 13 52628 2
. PRO 14 14 52628 2
. GLN 15 15 52628 2
. ASN 16 16 52628 2
. TYR 17 17 52628 2
. LEU 18 18 52628 2
. PHE 19 19 52628 2
. GLY 20 20 52628 2
. CYS 21 21 52628 2
. GLU 22 22 52628 2
. LEU 23 23 52628 2
. LYS 24 24 52628 2
. ALA 25 25 52628 2
. ASP 26 26 52628 2
. LYS 27 27 52628 2
. ASP 28 28 52628 2
. TYR 29 29 52628 2
. HIS 30 30 52628 2
. PHE 31 31 52628 2
. LYS 32 32 52628 2
. VAL 33 33 52628 2
. ASP 34 34 52628 2
. ASN 35 35 52628 2
. ASP 36 36 52628 2
. GLU 37 37 52628 2
. ASN 38 38 52628 2
. GLU 39 39 52628 2
. HIS 40 40 52628 2
. GLN 41 41 52628 2
. LEU 42 42 52628 2
. SER 43 43 52628 2
. LEU 44 44 52628 2
. ARG 45 45 52628 2
. THR 46 46 52628 2
. VAL 47 47 52628 2
. SER 48 48 52628 2
. LEU 49 49 52628 2
. GLY 50 50 52628 2
. ALA 51 51 52628 2
. GLY 52 52 52628 2
. ALA 53 53 52628 2
. LYS 54 54 52628 2
. ASP 55 55 52628 2
. GLU 56 56 52628 2
. LEU 57 57 52628 2
. HIS 58 58 52628 2
. ILE 59 59 52628 2
. VAL 60 60 52628 2
. GLU 61 61 52628 2
. ALA 62 62 52628 2
. GLU 63 63 52628 2
. ALA 64 64 52628 2
. MET 65 65 52628 2
. ASN 66 66 52628 2
. TYR 67 67 52628 2
. GLU 68 68 52628 2
. GLY 69 69 52628 2
. SER 70 70 52628 2
. PRO 71 71 52628 2
. ILE 72 72 52628 2
. LYS 73 73 52628 2
. VAL 74 74 52628 2
. THR 75 75 52628 2
. LEU 76 76 52628 2
. ALA 77 77 52628 2
. THR 78 78 52628 2
. LEU 79 79 52628 2
. LYS 80 80 52628 2
. MET 81 81 52628 2
. SER 82 82 52628 2
. VAL 83 83 52628 2
. GLN 84 84 52628 2
. PRO 85 85 52628 2
. THR 86 86 52628 2
. VAL 87 87 52628 2
. SER 88 88 52628 2
. LEU 89 89 52628 2
. GLY 90 90 52628 2
. GLY 91 91 52628 2
. PHE 92 92 52628 2
. GLU 93 93 52628 2
. ILE 94 94 52628 2
. THR 95 95 52628 2
. PRO 96 96 52628 2
. PRO 97 97 52628 2
. VAL 98 98 52628 2
. VAL 99 99 52628 2
. LEU 100 100 52628 2
. ARG 101 101 52628 2
. LEU 102 102 52628 2
. LYS 103 103 52628 2
. CYS 104 104 52628 2
. GLY 105 105 52628 2
. SER 106 106 52628 2
. GLY 107 107 52628 2
. PRO 108 108 52628 2
. VAL 109 109 52628 2
. HIS 110 110 52628 2
. ILE 111 111 52628 2
. SER 112 112 52628 2
. GLY 113 113 52628 2
. GLN 114 114 52628 2
. HIS 115 115 52628 2
. LEU 116 116 52628 2
. VAL 117 117 52628 2
. ALA 118 118 52628 2
. VAL 119 119 52628 2
. GLU 120 120 52628 2
. GLU 121 121 52628 2
. ASP 122 122 52628 2
. ALA 123 123 52628 2
. GLU 124 124 52628 2
. SER 125 125 52628 2
. GLU 126 126 52628 2
. ASP 127 127 52628 2
. GLU 128 128 52628 2
. GLU 129 129 52628 2
. GLU 130 130 52628 2
. GLU 131 131 52628 2
. ASP 132 132 52628 2
. VAL 133 133 52628 2
. LYS 134 134 52628 2
. LEU 135 135 52628 2
. LEU 136 136 52628 2
. SER 137 137 52628 2
. ILE 138 138 52628 2
. SER 139 139 52628 2
. GLY 140 140 52628 2
. LYS 141 141 52628 2
. ARG 142 142 52628 2
. SER 143 143 52628 2
. ALA 144 144 52628 2
. PRO 145 145 52628 2
. GLY 146 146 52628 2
. GLY 147 147 52628 2
. GLY 148 148 52628 2
. SER 149 149 52628 2
. LYS 150 150 52628 2
. VAL 151 151 52628 2
. PRO 152 152 52628 2
. GLN 153 153 52628 2
. LYS 154 154 52628 2
. LYS 155 155 52628 2
. VAL 156 156 52628 2
. LYS 157 157 52628 2
. LEU 158 158 52628 2
. ALA 159 159 52628 2
. ALA 160 160 52628 2
. ASP 161 161 52628 2
. GLU 162 162 52628 2
. ASP 163 163 52628 2
. ASP 164 164 52628 2
. ASP 165 165 52628 2
. ASP 166 166 52628 2
. ASP 167 167 52628 2
. ASP 168 168 52628 2
. GLU 169 169 52628 2
. GLU 170 170 52628 2
. ASP 171 171 52628 2
. ASP 172 172 52628 2
. ASP 173 173 52628 2
. GLU 174 174 52628 2
. ASP 175 175 52628 2
. ASP 176 176 52628 2
. ASP 177 177 52628 2
. ASP 178 178 52628 2
. ASP 179 179 52628 2
. ASP 180 180 52628 2
. PHE 181 181 52628 2
. ASP 182 182 52628 2
. ASP 183 183 52628 2
. GLU 184 184 52628 2
. GLU 185 185 52628 2
. ALA 186 186 52628 2
. GLU 187 187 52628 2
. GLU 188 188 52628 2
. LYS 189 189 52628 2
. ALA 190 190 52628 2
. PRO 191 191 52628 2
. VAL 192 192 52628 2
. LYS 193 193 52628 2
. LYS 194 194 52628 2
. SER 195 195 52628 2
. ILE 196 196 52628 2
. ARG 197 197 52628 2
. ASP 198 198 52628 2
. THR 199 199 52628 2
. PRO 200 200 52628 2
. ALA 201 201 52628 2
. LYS 202 202 52628 2
. ASN 203 203 52628 2
. ALA 204 204 52628 2
. GLN 205 205 52628 2
. LYS 206 206 52628 2
. SER 207 207 52628 2
. ASN 208 208 52628 2
. GLN 209 209 52628 2
. ASN 210 210 52628 2
. GLY 211 211 52628 2
. LYS 212 212 52628 2
. ASP 213 213 52628 2
. SER 214 214 52628 2
. LYS 215 215 52628 2
. PRO 216 216 52628 2
. SER 217 217 52628 2
. SER 218 218 52628 2
. THR 219 219 52628 2
. PRO 220 220 52628 2
. ARG 221 221 52628 2
. SER 222 222 52628 2
. LYS 223 223 52628 2
. GLY 224 224 52628 2
. GLN 225 225 52628 2
. GLU 226 226 52628 2
. SER 227 227 52628 2
. PHE 228 228 52628 2
. LYS 229 229 52628 2
. LYS 230 230 52628 2
. GLN 231 231 52628 2
. GLU 232 232 52628 2
. LYS 233 233 52628 2
. THR 234 234 52628 2
. PRO 235 235 52628 2
. LYS 236 236 52628 2
. THR 237 237 52628 2
. PRO 238 238 52628 2
. LYS 239 239 52628 2
. GLY 240 240 52628 2
. PRO 241 241 52628 2
. SER 242 242 52628 2
. SER 243 243 52628 2
. VAL 244 244 52628 2
. GLU 245 245 52628 2
. ASP 246 246 52628 2
. ILE 247 247 52628 2
. LYS 248 248 52628 2
. ALA 249 249 52628 2
. LYS 250 250 52628 2
. MET 251 251 52628 2
. GLN 252 252 52628 2
. ALA 253 253 52628 2
. SER 254 254 52628 2
. ILE 255 255 52628 2
. GLU 256 256 52628 2
. LYS 257 257 52628 2
. GLY 258 258 52628 2
. GLY 259 259 52628 2
. SER 260 260 52628 2
. LEU 261 261 52628 2
. PRO 262 262 52628 2
. LYS 263 263 52628 2
. VAL 264 264 52628 2
. GLU 265 265 52628 2
. ALA 266 266 52628 2
. LYS 267 267 52628 2
. PHE 268 268 52628 2
. ILE 269 269 52628 2
. ASN 270 270 52628 2
. TYR 271 271 52628 2
. VAL 272 272 52628 2
. LYS 273 273 52628 2
. ASN 274 274 52628 2
. CYS 275 275 52628 2
. PHE 276 276 52628 2
. ARG 277 277 52628 2
. MET 278 278 52628 2
. THR 279 279 52628 2
. ASP 280 280 52628 2
. GLN 281 281 52628 2
. GLU 282 282 52628 2
. ALA 283 283 52628 2
. ILE 284 284 52628 2
. GLN 285 285 52628 2
. ASP 286 286 52628 2
. LEU 287 287 52628 2
. TRP 288 288 52628 2
. GLN 289 289 52628 2
. TRP 290 290 52628 2
. ARG 291 291 52628 2
. LYS 292 292 52628 2
. SER 293 293 52628 2
. LEU 294 294 52628 2
stop_
save_
####################
# Natural source #
####################
save_natural_source_1
_Entity_natural_src_list.Sf_category natural_source
_Entity_natural_src_list.Sf_framecode natural_source_1
_Entity_natural_src_list.Entry_ID 52628
_Entity_natural_src_list.ID 1
loop_
_Entity_natural_src.ID
_Entity_natural_src.Entity_ID
_Entity_natural_src.Entity_label
_Entity_natural_src.Entity_chimera_segment_ID
_Entity_natural_src.NCBI_taxonomy_ID
_Entity_natural_src.Type
_Entity_natural_src.Common
_Entity_natural_src.Organism_name_scientific
_Entity_natural_src.Organism_name_common
_Entity_natural_src.Organism_acronym
_Entity_natural_src.ICTVdb_decimal_code
_Entity_natural_src.Superkingdom
_Entity_natural_src.Kingdom
_Entity_natural_src.Genus
_Entity_natural_src.Species
_Entity_natural_src.Strain
_Entity_natural_src.Variant
_Entity_natural_src.Organ
_Entity_natural_src.Tissue
_Entity_natural_src.Tissue_fraction
_Entity_natural_src.Cell_line
_Entity_natural_src.Cell_type
_Entity_natural_src.ATCC_number
_Entity_natural_src.Organelle
_Entity_natural_src.Secretion
_Entity_natural_src.Plasmid
_Entity_natural_src.Gene_mnemonic
_Entity_natural_src.Details
_Entity_natural_src.Entry_ID
_Entity_natural_src.Entity_natural_src_list_ID
1 1 $entity_1 . 9606 organism . 'Homo sapiens' Human . . Eukaryota Metazoa Homo sapiens . . . . . . . . . . . . . 52628 1
2 2 $entity_2 . 9606 organism . 'Homo sapiens' Human . . Eukaryota Metazoa Homo sapiens . . . . . . . . . . . . . 52628 1
stop_
save_
#########################
# Experimental source #
#########################
save_experimental_source_1
_Entity_experimental_src_list.Sf_category experimental_source
_Entity_experimental_src_list.Sf_framecode experimental_source_1
_Entity_experimental_src_list.Entry_ID 52628
_Entity_experimental_src_list.ID 1
loop_
_Entity_experimental_src.ID
_Entity_experimental_src.Entity_ID
_Entity_experimental_src.Entity_label
_Entity_experimental_src.Entity_chimera_segment_ID
_Entity_experimental_src.Production_method
_Entity_experimental_src.Host_org_scientific_name
_Entity_experimental_src.Host_org_name_common
_Entity_experimental_src.Host_org_details
_Entity_experimental_src.Host_org_NCBI_taxonomy_ID
_Entity_experimental_src.Host_org_genus
_Entity_experimental_src.Host_org_species
_Entity_experimental_src.Host_org_strain
_Entity_experimental_src.Host_org_variant
_Entity_experimental_src.Host_org_ATCC_number
_Entity_experimental_src.Vector_type
_Entity_experimental_src.PDBview_host_org_vector_name
_Entity_experimental_src.PDBview_plasmid_name
_Entity_experimental_src.Vector_name
_Entity_experimental_src.Vector_details
_Entity_experimental_src.Vendor_name
_Entity_experimental_src.Details
_Entity_experimental_src.Entry_ID
_Entity_experimental_src.Entity_experimental_src_list_ID
1 1 $entity_1 . 'recombinant technology' 'Escherichia coli' . . . Escherichia coli . . . plasmid . . pET28a . . . 52628 1
2 2 $entity_2 . 'recombinant technology' 'Escherichia coli' . . . Escherichia coli . . . plasmid . . pET28a . . . 52628 1
stop_
save_
#####################################
# Sample contents and methodology #
#####################################
########################
# Sample description #
########################
save_sample_1
_Sample.Sf_category sample
_Sample.Sf_framecode sample_1
_Sample.Entry_ID 52628
_Sample.ID 1
_Sample.Name 'p14ARF-NPM1 condensate'
_Sample.Type 'gel solid'
_Sample.Sub_type .
_Sample.Details .
_Sample.Aggregate_sample_number 1
_Sample.Solvent_system na
_Sample.Preparation_date .
_Sample.Preparation_expiration_date .
_Sample.Polycrystallization_protocol .
_Sample.Single_crystal_protocol .
_Sample.Crystal_grow_apparatus .
_Sample.Crystal_grow_atmosphere .
_Sample.Crystal_grow_details .
_Sample.Crystal_grow_method .
_Sample.Crystal_grow_method_cit_ID .
_Sample.Crystal_grow_pH .
_Sample.Crystal_grow_pH_range .
_Sample.Crystal_grow_pressure .
_Sample.Crystal_grow_pressure_esd .
_Sample.Crystal_grow_seeding .
_Sample.Crystal_grow_seeding_cit_ID .
_Sample.Crystal_grow_temp .
_Sample.Crystal_grow_temp_details .
_Sample.Crystal_grow_temp_esd .
_Sample.Crystal_grow_time .
_Sample.Oriented_sample_prep_protocol .
_Sample.Lyophilization_cryo_protectant .
_Sample.Storage_protocol .
loop_
_Sample_component.ID
_Sample_component.Mol_common_name
_Sample_component.Isotopic_labeling
_Sample_component.Assembly_ID
_Sample_component.Assembly_label
_Sample_component.Entity_ID
_Sample_component.Entity_label
_Sample_component.Product_ID
_Sample_component.Type
_Sample_component.Concentration_val
_Sample_component.Concentration_val_min
_Sample_component.Concentration_val_max
_Sample_component.Concentration_val_units
_Sample_component.Concentration_val_err
_Sample_component.Vendor
_Sample_component.Vendor_product_name
_Sample_component.Vendor_product_code
_Sample_component.Entry_ID
_Sample_component.Sample_ID
1 p14ARF '[U-100% 13C; U-100% 15N]' . . 1 $entity_1 . . 200 . . uM . . . . 52628 1
2 NPM1 'natural abundance' . . 2 $entity_2 . . 1 . . mM . . . . 52628 1
stop_
save_
#######################
# Sample conditions #
#######################
save_sample_conditions_1
_Sample_condition_list.Sf_category sample_conditions
_Sample_condition_list.Sf_framecode sample_conditions_1
_Sample_condition_list.Entry_ID 52628
_Sample_condition_list.ID 1
_Sample_condition_list.Name na
_Sample_condition_list.Details .
loop_
_Sample_condition_variable.Type
_Sample_condition_variable.Val
_Sample_condition_variable.Val_err
_Sample_condition_variable.Val_units
_Sample_condition_variable.Entry_ID
_Sample_condition_variable.Sample_condition_list_ID
pressure 1 . atm 52628 1
stop_
save_
############################
# Computer software used #
############################
save_software_1
_Software.Sf_category software
_Software.Sf_framecode software_1
_Software.Entry_ID 52628
_Software.ID 1
_Software.Type .
_Software.Name TOPSPIN
_Software.Version .
_Software.DOI .
_Software.Details .
loop_
_Task.Task
_Task.Software_module
_Task.Entry_ID
_Task.Software_ID
collection . 52628 1
stop_
save_
#########################
# Experimental detail #
#########################
##################################
# NMR Spectrometer definitions #
##################################
save_NMR_spectrometer_1
_NMR_spectrometer.Sf_category NMR_spectrometer
_NMR_spectrometer.Sf_framecode NMR_spectrometer_1
_NMR_spectrometer.Entry_ID 52628
_NMR_spectrometer.ID 1
_NMR_spectrometer.Name 'AVANCE NEO'
_NMR_spectrometer.Details .
_NMR_spectrometer.Manufacturer Bruker
_NMR_spectrometer.Model 'AVANCE NEO'
_NMR_spectrometer.Serial_number .
_NMR_spectrometer.Field_strength 600
save_
#############################
# NMR applied experiments #
#############################
save_experiment_list_1
_Experiment_list.Sf_category experiment_list
_Experiment_list.Sf_framecode experiment_list_1
_Experiment_list.Entry_ID 52628
_Experiment_list.ID 1
_Experiment_list.Details .
loop_
_Experiment.ID
_Experiment.Name
_Experiment.Raw_data_flag
_Experiment.NUS_flag
_Experiment.Interleaved_flag
_Experiment.NMR_spec_expt_ID
_Experiment.NMR_spec_expt_label
_Experiment.MS_expt_ID
_Experiment.MS_expt_label
_Experiment.SAXS_expt_ID
_Experiment.SAXS_expt_label
_Experiment.FRET_expt_ID
_Experiment.FRET_expt_label
_Experiment.EMR_expt_ID
_Experiment.EMR_expt_label
_Experiment.Sample_ID
_Experiment.Sample_label
_Experiment.Sample_state
_Experiment.Sample_volume
_Experiment.Sample_volume_units
_Experiment.Sample_condition_list_ID
_Experiment.Sample_condition_list_label
_Experiment.Sample_spinning_rate
_Experiment.Sample_angle
_Experiment.NMR_tube_type
_Experiment.NMR_spectrometer_ID
_Experiment.NMR_spectrometer_label
_Experiment.NMR_spectrometer_probe_ID
_Experiment.NMR_spectrometer_probe_label
_Experiment.NMR_spectral_processing_ID
_Experiment.NMR_spectral_processing_label
_Experiment.Mass_spectrometer_ID
_Experiment.Mass_spectrometer_label
_Experiment.Xray_instrument_ID
_Experiment.Xray_instrument_label
_Experiment.Fluorescence_instrument_ID
_Experiment.Fluorescence_instrument_label
_Experiment.EMR_instrument_ID
_Experiment.EMR_instrument_label
_Experiment.Chromatographic_system_ID
_Experiment.Chromatographic_system_label
_Experiment.Chromatographic_column_ID
_Experiment.Chromatographic_column_label
_Experiment.Details
_Experiment.Entry_ID
_Experiment.Experiment_list_ID
1 '2D 13C-13C DARR' no no no . . . . . . . . . . 1 $sample_1 isotropic . . 1 $sample_conditions_1 . . . 1 $NMR_spectrometer_1 . . . . . . . . . . . . . . . . . 52628 1
stop_
save_
####################
# NMR parameters #
####################
##############################
# Assigned chemical shifts #
##############################
################################
# Chemical shift referencing #
################################
save_chem_shift_reference_1
_Chem_shift_reference.Sf_category chem_shift_reference
_Chem_shift_reference.Sf_framecode chem_shift_reference_1
_Chem_shift_reference.Entry_ID 52628
_Chem_shift_reference.ID 1
_Chem_shift_reference.Name adamantane
_Chem_shift_reference.Details .
loop_
_Chem_shift_ref.Atom_type
_Chem_shift_ref.Atom_isotope_number
_Chem_shift_ref.Mol_common_name
_Chem_shift_ref.Atom_group
_Chem_shift_ref.Concentration_val
_Chem_shift_ref.Concentration_units
_Chem_shift_ref.Solvent
_Chem_shift_ref.Rank
_Chem_shift_ref.Chem_shift_units
_Chem_shift_ref.Chem_shift_val
_Chem_shift_ref.Ref_method
_Chem_shift_ref.Ref_type
_Chem_shift_ref.Indirect_shift_ratio
_Chem_shift_ref.External_ref_loc
_Chem_shift_ref.External_ref_sample_geometry
_Chem_shift_ref.External_ref_axis
_Chem_shift_ref.Ref_correction_type
_Chem_shift_ref.Correction_val
_Chem_shift_ref.Entry_ID
_Chem_shift_ref.Chem_shift_reference_ID
C 13 aadamantane 'C delta' . . . . ppm 38.5 na direct 1 . . . . . 52628 1
N 15 adamantane na . . . . ppm 0 na direct 1 . . . . . 52628 1
stop_
save_
###################################
# Assigned chemical shift lists #
###################################
###################################################################
# Chemical Shift Ambiguity Index Value Definitions #
# #
# The values other than 1 are used for those atoms with different #
# chemical shifts that cannot be assigned to stereospecific atoms #
# or to specific residues or chains. #
# #
# Index Value Definition #
# #
# 1 Unique (including isolated methyl protons, #
# geminal atoms, and geminal methyl #
# groups with identical chemical shifts) #
# (e.g. ILE HD11, HD12, HD13 protons) #
# 2 Ambiguity of geminal atoms or geminal methyl #
# proton groups (e.g. ASP HB2 and HB3 #
# protons, LEU CD1 and CD2 carbons, or #
# LEU HD11, HD12, HD13 and HD21, HD22, #
# HD23 methyl protons) #
# 3 Aromatic atoms on opposite sides of #
# symmetrical rings (e.g. TYR HE1 and HE2 #
# protons) #
# 4 Intraresidue ambiguities (e.g. LYS HG and #
# HD protons or TRP HZ2 and HZ3 protons) #
# 5 Interresidue ambiguities (LYS 12 vs. LYS 27) #
# 6 Intermolecular ambiguities (e.g. ASP 31 CA #
# in monomer 1 and ASP 31 CA in monomer 2 #
# of an asymmetrical homodimer, duplex #
# DNA assignments, or other assignments #
# that may apply to atoms in one or more #
# molecule in the molecular assembly) #
# 9 Ambiguous, specific ambiguity not defined #
# #
###################################################################
save_assigned_chemical_shifts_1
_Assigned_chem_shift_list.Sf_category assigned_chemical_shifts
_Assigned_chem_shift_list.Sf_framecode assigned_chemical_shifts_1
_Assigned_chem_shift_list.Entry_ID 52628
_Assigned_chem_shift_list.ID 1
_Assigned_chem_shift_list.Name 'p14ARF solid state assignment'
_Assigned_chem_shift_list.Sample_condition_list_ID 1
_Assigned_chem_shift_list.Sample_condition_list_label $sample_conditions_1
_Assigned_chem_shift_list.Chem_shift_reference_ID 1
_Assigned_chem_shift_list.Chem_shift_reference_label $chem_shift_reference_1
_Assigned_chem_shift_list.Chem_shift_1H_err .
_Assigned_chem_shift_list.Chem_shift_13C_err .
_Assigned_chem_shift_list.Chem_shift_15N_err .
_Assigned_chem_shift_list.Chem_shift_31P_err .
_Assigned_chem_shift_list.Chem_shift_2H_err .
_Assigned_chem_shift_list.Chem_shift_19F_err .
_Assigned_chem_shift_list.Error_derivation_method .
_Assigned_chem_shift_list.Details .
_Assigned_chem_shift_list.Text_data_format .
_Assigned_chem_shift_list.Text_data .
loop_
_Chem_shift_experiment.Experiment_ID
_Chem_shift_experiment.Experiment_name
_Chem_shift_experiment.Sample_ID
_Chem_shift_experiment.Sample_label
_Chem_shift_experiment.Sample_state
_Chem_shift_experiment.Entry_ID
_Chem_shift_experiment.Assigned_chem_shift_list_ID
1 '2D 13C-13C DARR' . . . 52628 1
stop_
loop_
_Chem_shift_software.Software_ID
_Chem_shift_software.Software_label
_Chem_shift_software.Method_ID
_Chem_shift_software.Method_label
_Chem_shift_software.Entry_ID
_Chem_shift_software.Assigned_chem_shift_list_ID
1 $software_1 . . 52628 1
stop_
loop_
_Atom_chem_shift.ID
_Atom_chem_shift.Assembly_atom_ID
_Atom_chem_shift.Entity_assembly_ID
_Atom_chem_shift.Entity_assembly_asym_ID
_Atom_chem_shift.Entity_ID
_Atom_chem_shift.Comp_index_ID
_Atom_chem_shift.Seq_ID
_Atom_chem_shift.Comp_ID
_Atom_chem_shift.Atom_ID
_Atom_chem_shift.Atom_type
_Atom_chem_shift.Atom_isotope_number
_Atom_chem_shift.Val
_Atom_chem_shift.Val_err
_Atom_chem_shift.Assign_fig_of_merit
_Atom_chem_shift.Ambiguity_code
_Atom_chem_shift.Ambiguity_set_ID
_Atom_chem_shift.Occupancy
_Atom_chem_shift.Resonance_ID
_Atom_chem_shift.Auth_entity_assembly_ID
_Atom_chem_shift.Auth_asym_ID
_Atom_chem_shift.Auth_seq_ID
_Atom_chem_shift.Auth_comp_ID
_Atom_chem_shift.Auth_atom_ID
_Atom_chem_shift.Details
_Atom_chem_shift.Entry_ID
_Atom_chem_shift.Assigned_chem_shift_list_ID
1 . 1 . 1 29 29 VAL C C 13 173.10 . . 1 . . . . . 7 VAL C . 52628 1
2 . 1 . 1 29 29 VAL CA C 13 59.04 . . 6 1 . . . . 7 VAL CA . 52628 1
3 . 1 . 1 29 29 VAL CB C 13 32.69 . . 6 1 . . . . 7 VAL CB . 52628 1
4 . 1 . 1 29 29 VAL CG1 C 13 19.62 . . 2 . . . . . 7 VAL CG1 . 52628 1
5 . 1 . 1 29 29 VAL CG2 C 13 19.62 . . 2 . . . . . 7 VAL CG2 . 52628 1
6 . 1 . 1 30 30 THR C C 13 171.60 . . 1 . . . . . 8 THR C . 52628 1
7 . 1 . 1 30 30 THR CA C 13 60.16 . . 6 1 . . . . 8 THR CA . 52628 1
8 . 1 . 1 30 30 THR CB C 13 67.92 . . 6 1 . . . . 8 THR CB . 52628 1
9 . 1 . 1 30 30 THR CG2 C 13 19.88 . . 6 1 . . . . 8 THR CG2 . 52628 1
10 . 1 . 1 30 30 THR N N 15 125.10 . . 6 1 . . . . 8 THR N . 52628 1
11 . 1 . 1 31 31 LEU C C 13 172.90 . . 1 . . . . . 9 LEU C . 52628 1
12 . 1 . 1 31 31 LEU CA C 13 51.65 . . 6 1 . . . . 9 LEU CA . 52628 1
13 . 1 . 1 31 31 LEU CB C 13 41.34 . . 6 1 . . . . 9 LEU CB . 52628 1
14 . 1 . 1 31 31 LEU CG C 13 25.49 . . 6 1 . . . . 9 LEU CG . 52628 1
15 . 1 . 1 31 31 LEU N N 15 126.70 . . 1 . . . . . 9 LEU N . 52628 1
16 . 1 . 1 32 32 ARG C C 13 173.70 . . 1 . . . . . 10 ARG C . 52628 1
17 . 1 . 1 32 32 ARG CA C 13 52.82 . . 1 . . . . . 10 ARG CA . 52628 1
18 . 1 . 1 32 32 ARG CB C 13 30.21 . . 1 . . . . . 10 ARG CB . 52628 1
19 . 1 . 1 32 32 ARG CD C 13 41.91 . . 1 . . . . . 10 ARG CD . 52628 1
20 . 1 . 1 32 32 ARG N N 15 127.90 . . 1 . . . . . 10 ARG N . 52628 1
21 . 1 . 1 33 33 ILE C C 13 173.10 . . 1 . . . . . 11 ILE C . 52628 1
22 . 1 . 1 33 33 ILE CA C 13 58.35 . . 1 . . . . . 11 ILE CA . 52628 1
23 . 1 . 1 33 33 ILE CB C 13 37.91 . . 1 . . . . . 11 ILE CB . 52628 1
24 . 1 . 1 33 33 ILE CG1 C 13 25.20 . . 1 . . . . . 11 ILE CG1 . 52628 1
25 . 1 . 1 33 33 ILE CG2 C 13 16.05 . . 1 . . . . . 11 ILE CG2 . 52628 1
26 . 1 . 1 33 33 ILE CD1 C 13 12.18 . . 1 . . . . . 11 ILE CD1 . 52628 1
27 . 1 . 1 35 35 ARG CA C 13 52.64 . . 1 . . . . . 13 ARG CA . 52628 1
28 . 1 . 1 35 35 ARG CB C 13 29.72 . . 1 . . . . . 13 ARG CB . 52628 1
29 . 1 . 1 35 35 ARG CG C 13 25.44 . . 1 . . . . . 13 ARG CG . 52628 1
30 . 1 . 1 35 35 ARG CD C 13 41.48 . . 1 . . . . . 13 ARG CD . 52628 1
31 . 1 . 1 35 35 ARG CZ C 13 157.60 . . 1 . . . . . 13 ARG CZ . 52628 1
32 . 1 . 1 36 36 ALA C C 13 173.60 . . 1 . . . . . 14 ALA C . 52628 1
33 . 1 . 1 36 36 ALA CA C 13 48.69 . . 1 . . . . . 14 ALA CA . 52628 1
34 . 1 . 1 36 36 ALA CB C 13 16.63 . . 1 . . . . . 14 ALA CB . 52628 1
35 . 1 . 1 36 36 ALA N N 15 125.20 . . 1 . . . . . 14 ALA N . 52628 1
36 . 1 . 1 40 40 PRO CA C 13 58.97 . . 1 . . . . . 18 PRO CA . 52628 1
37 . 1 . 1 40 40 PRO CB C 13 30.12 . . 1 . . . . . 18 PRO CB . 52628 1
38 . 1 . 1 40 40 PRO CG C 13 25.25 . . 1 . . . . . 18 PRO CG . 52628 1
39 . 1 . 1 40 40 PRO CD C 13 47.74 . . 1 . . . . . 18 PRO CD . 52628 1
40 . 1 . 1 40 40 PRO N N 15 129.60 . . 1 . . . . . 18 PRO N . 52628 1
41 . 1 . 1 41 41 ARG CA C 13 52.24 . . 1 . . . . . 19 ARG CA . 52628 1
42 . 1 . 1 41 41 ARG CD C 13 42.33 . . 1 . . . . . 19 ARG CD . 52628 1
43 . 1 . 1 47 47 VAL C C 13 172.50 . . 1 . . . . . 25 VAL C . 52628 1
44 . 1 . 1 47 47 VAL CA C 13 58.98 . . 1 . . . . . 25 VAL CA . 52628 1
45 . 1 . 1 47 47 VAL CB C 13 31.97 . . 1 . . . . . 25 VAL CB . 52628 1
46 . 1 . 1 47 47 VAL CG1 C 13 19.79 . . 2 . . . . . 25 VAL CG1 . 52628 1
47 . 1 . 1 47 47 VAL CG2 C 13 19.79 . . 2 . . . . . 25 VAL CG2 . 52628 1
48 . 1 . 1 47 47 VAL N N 15 128.10 . . 1 . . . . . 25 VAL N . 52628 1
49 . 1 . 1 48 48 HIS CA C 13 53.87 . . 1 . . . . . 26 HIS CA . 52628 1
50 . 1 . 1 48 48 HIS CB C 13 28.20 . . 1 . . . . . 26 HIS CB . 52628 1
51 . 1 . 1 48 48 HIS CG C 13 131.2 . . 6 1 . . . . 26 HIS CG . 52628 1
52 . 1 . 1 48 48 HIS CD2 C 13 118.00 . . 1 . . . . . 26 HIS CD2 . 52628 1
53 . 1 . 1 48 48 HIS CE1 C 13 137.4 . . 6 1 . . . . 26 HIS CE1 . 52628 1
54 . 1 . 1 49 49 ILE C C 13 172.9 . . 1 . . . . . 27 ILE C . 52628 1
55 . 1 . 1 49 49 ILE CA C 13 55.44 . . 1 . . . . . 27 ILE CA . 52628 1
56 . 1 . 1 49 49 ILE CB C 13 36.96 . . 1 . . . . . 27 ILE CB . 52628 1
57 . 1 . 1 49 49 ILE CG1 C 13 25.09 . . 1 . . . . . 27 ILE CG1 . 52628 1
58 . 1 . 1 49 49 ILE CG2 C 13 16.05 . . 1 . . . . . 27 ILE CG2 . 52628 1
59 . 1 . 1 49 49 ILE CD1 C 13 12.04 . . 1 . . . . . 27 ILE CD1 . 52628 1
60 . 1 . 1 50 50 PRO CA C 13 61.18 . . 1 . . . . . 28 PRO CA . 52628 1
61 . 1 . 1 50 50 PRO CB C 13 30.45 . . 1 . . . . . 28 PRO CB . 52628 1
62 . 1 . 1 50 50 PRO CG C 13 25.79 . . 1 . . . . . 28 PRO CG . 52628 1
63 . 1 . 1 50 50 PRO CD C 13 49.07 . . 1 . . . . . 28 PRO CD . 52628 1
64 . 1 . 1 50 50 PRO N N 15 134.70 . . 1 . . . . . 28 PRO N . 52628 1
65 . 1 . 1 54 54 GLY CA C 13 40.95 . . 1 . . . . . 32 GLY CA . 52628 1
66 . 1 . 1 55 55 GLU C C 13 173.90 . . 1 . . . . . 33 GLU C . 52628 1
67 . 1 . 1 55 55 GLU CA C 13 55.94 . . 1 . . . . . 33 GLU CA . 52628 1
68 . 1 . 1 55 55 GLU CB C 13 27.76 . . 1 . . . . . 33 GLU CB . 52628 1
69 . 1 . 1 55 55 GLU CG C 13 34.42 . . 1 . . . . . 33 GLU CG . 52628 1
70 . 1 . 1 55 55 GLU CD C 13 181.70 . . 1 . . . . . 33 GLU CD . 52628 1
71 . 1 . 1 57 57 ALA C C 13 176.00 . . 1 . . . . . 35 ALA C . 52628 1
72 . 1 . 1 57 57 ALA CA C 13 50.97 . . 1 . . . . . 35 ALA CA . 52628 1
73 . 1 . 1 57 57 ALA CB C 13 17.54 . . 1 . . . . . 35 ALA CB . 52628 1
74 . 1 . 1 59 59 PRO C C 13 174.70 . . 1 . . . . . 37 PRO C . 52628 1
75 . 1 . 1 59 59 PRO CA C 13 60.99 . . 1 . . . . . 37 PRO CA . 52628 1
76 . 1 . 1 59 59 PRO CB C 13 30.03 . . 1 . . . . . 37 PRO CB . 52628 1
77 . 1 . 1 59 59 PRO CG C 13 25.45 . . 1 . . . . . 37 PRO CG . 52628 1
78 . 1 . 1 59 59 PRO CD C 13 48.64 . . 1 . . . . . 37 PRO CD . 52628 1
79 . 1 . 1 60 60 GLY C C 13 171.90 . . 1 . . . . . 38 GLY C . 52628 1
80 . 1 . 1 60 60 GLY CA C 13 43.17 . . 1 . . . . . 38 GLY CA . 52628 1
81 . 1 . 1 60 60 GLY N N 15 110.00 . . 1 . . . . . 38 GLY N . 52628 1
82 . 1 . 1 65 65 VAL C C 13 175.60 . . 1 . . . . . 43 VAL C . 52628 1
83 . 1 . 1 65 65 VAL CA C 13 64.76 . . 1 . . . . . 43 VAL CA . 52628 1
84 . 1 . 1 65 65 VAL CB C 13 29.33 . . 1 . . . . . 43 VAL CB . 52628 1
85 . 1 . 1 65 65 VAL CG1 C 13 19.84 . . 2 . . . . . 43 VAL CG1 . 52628 1
86 . 1 . 1 65 65 VAL CG2 C 13 19.84 . . 2 . . . . . 43 VAL CG2 . 52628 1
87 . 1 . 1 65 65 VAL N N 15 118.60 . . 1 . . . . . 43 VAL N . 52628 1
88 . 1 . 1 66 66 ALA C C 13 176.50 . . 1 . . . . . 44 ALA C . 52628 1
89 . 1 . 1 66 66 ALA CA C 13 53.27 . . 1 . . . . . 44 ALA CA . 52628 1
90 . 1 . 1 66 66 ALA CB C 13 16.43 . . 1 . . . . . 44 ALA CB . 52628 1
91 . 1 . 1 66 66 ALA N N 15 122.00 . . 1 . . . . . 44 ALA N . 52628 1
92 . 1 . 1 67 67 LEU C C 13 176.70 . . 1 . . . . . 45 LEU C . 52628 1
93 . 1 . 1 67 67 LEU CA C 13 55.77 . . 1 . . . . . 45 LEU CA . 52628 1
94 . 1 . 1 67 67 LEU CB C 13 39.91 . . 1 . . . . . 45 LEU CB . 52628 1
95 . 1 . 1 67 67 LEU CG C 13 24.76 . . 1 . . . . . 45 LEU CG . 52628 1
96 . 1 . 1 67 67 LEU CD1 C 13 21.62 . . 2 . . . . . 45 LEU CD1 . 52628 1
97 . 1 . 1 67 67 LEU CD2 C 13 21.62 . . 2 . . . . . 45 LEU CD2 . 52628 1
98 . 1 . 1 67 67 LEU N N 15 122.60 . . 1 . . . . . 45 LEU N . 52628 1
99 . 1 . 1 71 71 LEU C C 13 177.70 . . 1 . . . . . 49 LEU C . 52628 1
100 . 1 . 1 71 71 LEU CA C 13 55.88 . . 1 . . . . . 49 LEU CA . 52628 1
101 . 1 . 1 71 71 LEU CB C 13 39.79 . . 1 . . . . . 49 LEU CB . 52628 1
102 . 1 . 1 72 72 LEU CA C 13 55.90 . . 1 . . . . . 50 LEU CA . 52628 1
103 . 1 . 1 72 72 LEU CB C 13 39.75 . . 1 . . . . . 50 LEU CB . 52628 1
104 . 1 . 1 72 72 LEU CG C 13 24.94 . . 1 . . . . . 50 LEU CG . 52628 1
105 . 1 . 1 72 72 LEU N N 15 120.00 . . 1 . . . . . 50 LEU N . 52628 1
106 . 1 . 1 74 74 SER CA C 13 56.63 . . 1 . . . . . 52 SER CA . 52628 1
107 . 1 . 1 74 74 SER CB C 13 61.91 . . 1 . . . . . 52 SER CB . 52628 1
108 . 1 . 1 75 75 GLN CA C 13 53.17 . . 1 . . . . . 53 GLN CA . 52628 1
109 . 1 . 1 75 75 GLN CB C 13 27.45 . . 1 . . . . . 53 GLN CB . 52628 1
110 . 1 . 1 75 75 GLN CG C 13 31.87 . . 1 . . . . . 53 GLN CG . 52628 1
111 . 1 . 1 75 75 GLN CD C 13 178.10 . . 1 . . . . . 53 GLN CD . 52628 1
stop_
save_
save_assigned_chemical_shifts_2
_Assigned_chem_shift_list.Sf_category assigned_chemical_shifts
_Assigned_chem_shift_list.Sf_framecode assigned_chemical_shifts_2
_Assigned_chem_shift_list.Entry_ID 52628
_Assigned_chem_shift_list.ID 2
_Assigned_chem_shift_list.Name 'p14ARF solid state assignment'
_Assigned_chem_shift_list.Sample_condition_list_ID 1
_Assigned_chem_shift_list.Sample_condition_list_label $sample_conditions_1
_Assigned_chem_shift_list.Chem_shift_reference_ID 1
_Assigned_chem_shift_list.Chem_shift_reference_label $chem_shift_reference_1
_Assigned_chem_shift_list.Chem_shift_1H_err .
_Assigned_chem_shift_list.Chem_shift_13C_err .
_Assigned_chem_shift_list.Chem_shift_15N_err .
_Assigned_chem_shift_list.Chem_shift_31P_err .
_Assigned_chem_shift_list.Chem_shift_2H_err .
_Assigned_chem_shift_list.Chem_shift_19F_err .
_Assigned_chem_shift_list.Error_derivation_method .
_Assigned_chem_shift_list.Details .
_Assigned_chem_shift_list.Text_data_format .
_Assigned_chem_shift_list.Text_data .
loop_
_Chem_shift_experiment.Experiment_ID
_Chem_shift_experiment.Experiment_name
_Chem_shift_experiment.Sample_ID
_Chem_shift_experiment.Sample_label
_Chem_shift_experiment.Sample_state
_Chem_shift_experiment.Entry_ID
_Chem_shift_experiment.Assigned_chem_shift_list_ID
1 '2D 13C-13C DARR' . . . 52628 2
stop_
loop_
_Chem_shift_software.Software_ID
_Chem_shift_software.Software_label
_Chem_shift_software.Method_ID
_Chem_shift_software.Method_label
_Chem_shift_software.Entry_ID
_Chem_shift_software.Assigned_chem_shift_list_ID
1 $software_1 . . 52628 2
stop_
loop_
_Atom_chem_shift.ID
_Atom_chem_shift.Assembly_atom_ID
_Atom_chem_shift.Entity_assembly_ID
_Atom_chem_shift.Entity_assembly_asym_ID
_Atom_chem_shift.Entity_ID
_Atom_chem_shift.Comp_index_ID
_Atom_chem_shift.Seq_ID
_Atom_chem_shift.Comp_ID
_Atom_chem_shift.Atom_ID
_Atom_chem_shift.Atom_type
_Atom_chem_shift.Atom_isotope_number
_Atom_chem_shift.Val
_Atom_chem_shift.Val_err
_Atom_chem_shift.Assign_fig_of_merit
_Atom_chem_shift.Ambiguity_code
_Atom_chem_shift.Ambiguity_set_ID
_Atom_chem_shift.Occupancy
_Atom_chem_shift.Resonance_ID
_Atom_chem_shift.Auth_entity_assembly_ID
_Atom_chem_shift.Auth_asym_ID
_Atom_chem_shift.Auth_seq_ID
_Atom_chem_shift.Auth_comp_ID
_Atom_chem_shift.Auth_atom_ID
_Atom_chem_shift.Details
_Atom_chem_shift.Entry_ID
_Atom_chem_shift.Assigned_chem_shift_list_ID
1 . 1 . 1 29 29 VAL CA C 13 58.71 . . 6 2 . . . . 7 VAL CA . 52628 2
2 . 1 . 1 29 29 VAL CB C 13 31.68 . . 6 2 . . . . 7 VAL CB . 52628 2
3 . 1 . 1 30 30 THR CA C 13 58.80 . . 6 2 . . . . 8 THR CA . 52628 2
4 . 1 . 1 30 30 THR CB C 13 80.35 . . 6 2 . . . . 8 THR CB . 52628 2
5 . 1 . 1 30 30 THR CG2 C 13 19.58 . . 6 2 . . . . 8 THR CG2 . 52628 2
6 . 1 . 1 31 31 LEU CA C 13 52.70 . . 6 2 . . . . 9 LEU CA . 52628 2
7 . 1 . 1 31 31 LEU CB C 13 41.70 . . 6 2 . . . . 9 LEU CB . 52628 2
8 . 1 . 1 31 31 LEU CG C 13 25.45 . . 6 2 . . . . 9 LEU CG . 52628 2
9 . 1 . 1 48 48 HIS CG C 13 129.3 . . 6 2 . . . . 26 HIS CG . 52628 2
10 . 1 . 1 48 48 HIS CE1 C 13 135.5 . . 6 3 . . . . 26 HIS CE1 . 52628 2
stop_
save_