blastp BLASTP 2.3.0+ Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. bmrb nr BLOSUM62 10 11 1 F 2 Query_1 gnl|mdb|bmrb25613:2 chain_B 51 1 gnl|mdb|bmrb11016:2 bmrb11016:2 Chain B 53 1 101.293 251 4.32415e-26 49 49 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP T 2 gi|229122|prf||600165A 600165A insulin 9606 Homo sapiens 51 1 101.293 251 5.31505e-26 49 49 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP T 3 gnl|mdb|bmrb15464:2 bmrb15464:2 chain B 51 1 101.293 251 5.31505e-26 49 49 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP T 4 gnl|mdb|bmrb25260:2 bmrb25260:2 entity_2 51 1 101.293 251 5.31505e-26 49 49 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP T 5 gnl|mdb|bmrb25614:2 bmrb25614:2 chain_B 51 1 100.908 250 7.93628e-26 51 51 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT 6 gnl|mdb|bmrb25613:2 bmrb25613:2 chain_B 51 1 100.908 250 7.93628e-26 51 51 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT 7 gnl|mdb|bmrb34087:2 bmrb34087:2 Insulin 53 1 100.138 248 1.53598e-25 48 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCKFVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYC FVNQHLCGSHLVEALYLVCGERGFF TP T 8 gi|229096|prf||550086A 550086A insulin 9825 Sus scrofa domesticus 51 1 99.7525 247 1.97168e-25 48 48 1 49 1 49 49 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTP GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP 9 gi|229405|prf||720921A 720921A insulin 10068 Acomys cahirinus 51 1 99.3673 246 3.10755e-25 47 49 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVDQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKS GIV+QCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP + 10 gnl|mdb|bmrb25261:2 bmrb25261:2 entity_2 51 1 98.9821 245 3.24515e-25 48 49 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGEQGFFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGE+GFF TP T 11 gnl|mdb|bmrb18921:2 bmrb18921:2 chain_B 51 1 98.5969 244 6.14826e-25 48 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGHFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERG F TP T 12 gnl|mdb|bmrb18923:2 bmrb18923:2 chain_B 51 1 98.5969 244 6.14826e-25 48 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGHFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERG F TP T 13 gnl|mdb|bmrb18924:2 bmrb18924:2 chain_B 51 1 98.5969 244 6.14826e-25 48 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGHFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERG F TP T 14 gnl|mdb|bmrb18925:2 bmrb18925:2 chain_B 51 1 98.5969 244 6.14826e-25 48 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGHFYTPKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERG F TP T 15 gi|229103|prf||560164A 560164A insulin 9796 Equus caballus 51 1 97.8265 242 1.0118e-24 47 47 1 49 1 49 49 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP GIVEQCCTGICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTP GIVEQCCT ICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP 16 gi|229095|prf||550085A 550085A insulin 9913 Bos taurus 51 1 97.8265 242 1.16474e-24 46 47 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCASVCSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKA GIVEQCC S+CSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP 17 gnl|mdb|bmrb18859:2 bmrb18859:2 entity_2 51 1 97.8265 242 1.16474e-24 48 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF T T 18 gnl|mdb|bmrb18858:2 bmrb18858:2 entity_2 51 1 97.8265 242 1.16474e-24 48 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF T T 19 gnl|mdb|bmrb26889:1 bmrb26889:1 bovine_insulin 51 1 97.8265 242 1.16474e-24 46 47 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCASVCSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKA GIVEQCC S+CSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP 20 gi|229407|prf||720922B 720922B insulin 2 10090 Mus musculus 51 1 97.4413 241 1.38507e-24 46 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVDQCCTSICSLYQLENYCNFVKQHLCGSHLVEALYLVCGERGFFYTPMS GIV+QCCTSICSLYQLENYCNFV QHLCGSHLVEALYLVCGERGFF TP + 21 gi|229541|prf||753014A 753014A insulin 36483 Cricetinae gen. sp. 51 1 97.4413 241 1.57725e-24 43 49 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVDQCCTSICSLYZLZBYCBFVNQHLCGSHLVEALYLVCGERGFFYTPKS GIV+QCCTSICSLY+L++YC+FVNQHLCGSHLVEALYLVCGERGFF TP + 22 gi|229168|prf||640291A 640291A insulin 9770 Balaenoptera physalus 51 1 97.0561 240 2.1128e-24 46 48 1 49 1 49 49 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP GIVEQCCTSICSLYELQNYCNFVNQHLCGSHLVEALYLVCGERGFFYTP GIVEQCCTSICSLY+L+NYCNFVNQHLCGSHLVEALYLVCGERGFF TP 23 gnl|mdb|bmrb16915:2 bmrb16915:2 entity, chain 2 54 1 96.6709 239 2.88951e-24 49 49 1 51 1 52 52 1 GIVEQCCTSICSLYQLENYCN-FVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNGFVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFF TP T 24 gi|229412|prf||721138A 721138A insulin 3806 Bauhinia purpurea 51 1 96.6709 239 3.51431e-24 45 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCASVCSLYQLENYCNFANQHLCGSHLVEALYLVCGERGFFYTPKA GIVEQCC S+CSLYQLENYCNF NQHLCGSHLVEALYLVCGERGFF TP 25 gnl|mdb|bmrb17803:2 bmrb17803:2 InsulinGR 2 53 1 96.6709 239 3.54946e-24 49 49 1 51 1 52 52 1 GIVEQCCTSICSLYQLENYCN-FVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNGFVNQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFF TP T 26 gi|229097|prf||550086B 550086B insulin 9940 Ovis aries 51 1 95.9005 237 5.90875e-24 45 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCAGVCSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKA GIVEQCC +CSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF TP 27 gnl|mdb|bmrb4997:2 bmrb4997:2 Insulin 51 1 95.9005 237 6.37384e-24 47 47 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYPTKT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF T 28 gi|229406|prf||720922A 720922A insulin 1 10090 Mus musculus 51 1 95.9005 237 6.95036e-24 45 47 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVDQCCTSICSLYQLENYCNFVKQHLCGPHLVEALYLVCGERGFFYTPKS GIV+QCCTSICSLYQLENYCNFV QHLCG HLVEALYLVCGERGFF TP + 29 gnl|mdb|bmrb34070:2 bmrb34070:2 Insulin 53 1 95.1301 235 1.13004e-23 48 48 1 51 1 52 52 1 GIVEQCCTSICSLYQLENYCN-FVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNSFVKQHLCGSHLVEALYLVCGERGFFYTPKT GIVEQCCTSICSLYQLENYCN FV QHLCGSHLVEALYLVCGERGFF TP T 30 gnl|mdb|bmrb25615:2 bmrb25615:2 chain_B 51 1 95.1301 235 1.16849e-23 48 48 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGGFYXPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERG F PXT 31 gnl|mdb|bmrb19978:2 bmrb19978:2 entity_2 51 1 95.1301 235 1.27416e-23 47 47 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCXSHLVEALYLVCGERGFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLC SHLVEALYLVCGERGFF T T 32 gnl|mdb|bmrb4266:1 bmrb4266:1 [D-AlaB26]destetra(B27-B30)insulin-B26-amide 47 1 94.7449 234 1.38198e-23 46 46 1 46 1 46 46 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF 33 gnl|mdb|bmrb6204:2 bmrb6204:2 AlaB12-DKP-insulin, chain B 51 1 93.9745 232 3.67926e-23 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSDLAEALYLVCGERGFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGS L EALYLVCGERGFF T T 34 gnl|mdb|bmrb15450:2 bmrb15450:2 B-chain 51 1 93.5893 231 4.23489e-23 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GITEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGFFYTKPT GI EQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCGERGFF T T 35 gnl|mdb|bmrb6203:2 bmrb6203:2 ThrB12-DKP-insulin, chain B 51 1 93.5893 231 4.23489e-23 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSDLTEALYLVCGERGFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGS L EALYLVCGERGFF T T 36 gnl|mdb|bmrb6205:2 bmrb6205:2 AbaB12-DKP-insulin, chain B 51 1 93.2041 230 5.85857e-23 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSDLXEALYLVCGERGFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGS L EALYLVCGERGFF T T 37 gnl|mdb|bmrb15455:2 bmrb15455:2 B_chain 51 1 93.2041 230 5.85857e-23 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIXEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGFFYTKPT GI EQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCGERGFF T T 38 gnl|mdb|bmrb15454:2 bmrb15454:2 B_chain 51 1 93.2041 230 5.85857e-23 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIXEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGFFYTKPT GI EQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCGERGFF T T 39 gi|229113|prf||580107B 580107B insulin 9755 Physeter catodon 50 1 93.2041 230 7.04843e-23 47 47 1 49 1 48 49 1 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCG-RGFFYTP GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCG RGFF TP 40 gnl|mdb|bmrb5246:2 bmrb5246:2 human insulin 51 1 93.2041 230 7.43271e-23 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GXVEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGFFYTKPT G VEQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCGERGFF T T 41 gnl|mdb|bmrb16343:2 bmrb16343:2 INSULIN_B_CHAIN 51 1 92.8189 229 9.95368e-23 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGXRGFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCG RGFF T T 42 gnl|mdb|bmrb17107:2 bmrb17107:2 Human Insulin 51 1 92.4337 228 1.18343e-22 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCXERXFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVC ER FF T T 43 gnl|mdb|bmrb19822:2 bmrb19822:2 entity_2 51 1 92.4337 228 1.20931e-22 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGFXYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCGERGF T T 44 gnl|mdb|bmrb16026:2 bmrb16026:2 INSULIN_B_CHAIN 51 1 92.4337 228 1.20931e-22 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGXFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCGERG F T T 45 gnl|mdb|bmrb16663:2 bmrb16663:2 entity, chain 2 51 1 92.4337 228 1.22246e-22 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCXSDLVEALYLVCGERGFFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLC S LVEALYLVCGERGFF T T 46 gnl|mdb|bmrb16027:2 bmrb16027:2 INSULIN_B_CHAIN 51 1 92.4337 228 1.30442e-22 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGAFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCGERG F T T 47 gnl|mdb|bmrb19979:1 bmrb19979:1 entity 51 1 91.6633 226 2.36449e-22 46 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCTSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGGFYTKPT GIVEQCCTSICSLYQLENYCNFVNQHLCGS LVEALYLVCGERG F T T 48 gnl|mdb|bmrb17108:2 bmrb17108:2 Human Insulin 51 1 90.5077 223 9.03595e-22 44 46 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GLLEQCCHSICSLYQLENYCNFVNQHLCGSDLVEALYLVCGERGFFYTKPT G++EQCC SICSLYQLENYCNFVNQHLCGS LVEALYLVCGERGFF T T 49 gi|229112|prf||580107A 580107A insulin 9768 Balaenoptera borealis 50 1 90.1225 222 1.26475e-21 45 45 1 49 1 48 49 1 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP GIVEQCCASTCSLYQLENYCNFVNQHLCGSHLVEALYLVCG-RGFFYTP GIVEQCC S CSLYQLENYCNFVNQHLCGSHLVEALYLVCG RGFF TP 50 gi|223223|prf||0609237A 0609237A insulin 10137 Hystrix cristata 51 1 89.3521 220 2.41611e-21 41 44 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVDQCCTGVCSLYQLQNYCNFVNQHLCGSHLVEALYLVCGNDGFFYRPKA GIV+QCCT +CSLYQL+NYCNFVNQHLCGSHLVEALYLVCG GFF P 51 gi|229408|prf||720927A 720927A insulin [Meleagris gallopavo] 9103 Meleagris gallopavo 51 1 89.3521 220 2.52284e-21 42 44 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCHNTCSLYQLENYCNAANQHLCGSHLVEALYLVCGERGFFYSPKA GIVEQCC + CSLYQLENYCN NQHLCGSHLVEALYLVCGERGFF +P 52 gi|229492|prf||742487A 742487A insulin 8730 Crotalus atrox 51 1 83.5741 205 4.07863e-19 38 44 1 51 1 51 51 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT GIVEQCCENTCSLYQLENYCNAPNQRLCGSHLVEALFLICGERGFYYSPRS GIVEQCC + CSLYQLENYCN NQ LCGSHLVEAL+L+CGERGF+ +P + 53 gi|225727|prf||1312249A 1312249A insulin 8017 Oncorhynchus gorbuscha 50 1 78.1814 191 4.78775e-17 35 40 1 49 1 49 49 0 GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP GIVEQCCHKPCNIFDLENYCNAAAQHLCGSHLVDALYLVCGEKGFFYNP GIVEQCC C+++ LENYCN QHLCGSHLV+ALYLVCGE+GFF P 54 gi|223836|prf||1002178A 1002178A insulin 7962 Cyprinus carpio 52 1 75.485 184 5.36844e-16 36 42 1 49 1 51 51 2 GIVEQCCTSICSLYQLENYCNFVN--QHLCGSHLVEALYLVCGERGFFXTP GIVEQCCHKPCSIFELQNYCNNAGAPQHLCGSHLVDALYLVCGDRGFFYTP GIVEQCC CS+++L+NYCN QHLCGSHLV+ALYLVCG+RGFF TP 55 gi|229285|prf||690500A 690500A insulin [Lophiiformes] 8070 Lophiiformes 51 1 72.7886 177 5.90675e-15 34 40 1 49 1 50 50 1 GIVEQCCTSICSLYQLENYCNFVN-QHLCGSHLVEALYLVCGERGFFXTP GIVEQCCHRPCNIFDLQNYCNVAPAQHLCGSHLVDALYLVCGDRGFFYNP GIVEQCC C+++ L+NYCN QHLCGSHLV+ALYLVCG+RGFF P 56 gi|109148522|ref|NP_001035835.1| NP_001035835 insulin, isoform 2 precursor [Homo sapiens] 9606 Homo sapiens gi|519881984|sp|F8WCM5.1|INSR2_HUMAN F8WCM5 RecName: Full=Insulin, isoform 2; AltName: Full=INS-IGF2 readthrough transcript protein 9606 Homo sapiens gi|151555001|gb|AAI48489.1| AAI48489 INS-IGF2 readthrough transcript, partial [synthetic construct] 32630 synthetic construct gi|157170102|gb|AAI53084.1| AAI53084 INS-IGF2 readthrough transcript [synthetic construct] 32630 synthetic construct 200 1 67.0106 162 8.47454e-12 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 57 gi|90297499|gb|ABD93452.1| ABD93452 INSIGF short transcript variant [Homo sapiens] 9606 Homo sapiens gi|90297501|gb|ABD93453.1| ABD93453 INSIGF long transcript variant [Homo sapiens] 9606 Homo sapiens 200 1 67.0106 162 8.47454e-12 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 58 gi|1351394455|ref|XP_024110664.1| XP_024110664 insulin isoform X1 [Pongo abelii] 9601 Pongo abelii 203 1 67.0106 162 8.58232e-12 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 59 gi|795357468|ref|XP_011785463.1| XP_011785463 PREDICTED: insulin isoform X1 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus 204 1 67.0106 162 8.61745e-12 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 60 gi|355566190|gb|EHH22569.1| EHH22569 hypothetical protein EGK_05866 [Macaca mulatta] 9544 Macaca mulatta 204 1 67.0106 162 9.14298e-12 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 61 gi|355751858|gb|EHH55978.1| EHH55978 hypothetical protein EGM_05294 [Macaca fascicularis] 9541 Macaca fascicularis 204 1 66.6254 161 1.34318e-11 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 62 gi|229401|prf||720710A 720710A insulin 10157 Myocastor coypus 51 1 63.5438 153 1.93318e-11 31 38 1 46 1 47 47 1 GIVEQCCTSICSLYQLENYCN-FVNQHLCGSHLVEALYLVCGERGFF GIVDQCCTNICSRNQLESYCNDYVSQRLCGSQLVDTLYSVCRHRGFY GIV+QCCT+ICS QLE+YCN +V+Q LCGS LV+ LY VC RGF+ 63 gi|1375002735|ref|XP_024430308.1| XP_024430308 insulin-like [Desmodus rotundus] 9430 Desmodus rotundus 197 1 65.855 159 2.52879e-11 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 64 gi|667288556|ref|XP_008576869.1| XP_008576869 PREDICTED: insulin, isoform 2-like [Galeopterus variegatus] 482537 Galeopterus variegatus 200 1 65.855 159 2.55954e-11 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 65 gi|671014011|ref|XP_008697844.1| XP_008697844 PREDICTED: insulin, isoform 2-like [Ursus maritimus] 29073 Ursus maritimus 202 1 65.855 159 2.57964e-11 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 66 gi|281344452|gb|EFB20036.1| EFB20036 hypothetical protein PANDA_008883, partial [Ailuropoda melanoleuca] 9646 Ailuropoda melanoleuca 212 1 65.855 159 2.68034e-11 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 67 gi|1387249096|ref|XP_015316816.2| XP_015316816 insulin isoform X1 [Bos taurus] 9913 Bos taurus 221 1 65.855 159 2.81053e-11 27 27 22 49 141 168 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 68 gi|1331868170|gb|PNJ16422.1| PNJ16422 INS isoform 4, partial [Pongo abelii] 9601 Pongo abelii 92 1 63.1586 152 6.0446e-11 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 69 gi|3776078|emb|CAA08766.1| CAA08766 insulin, partial [Homo sapiens] 9606 Homo sapiens 59 1 62.3882 150 6.43056e-11 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 70 gi|795357492|ref|XP_011785467.1| XP_011785467 PREDICTED: insulin isoform X4 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus gi|795357498|ref|XP_011785468.1| XP_011785468 PREDICTED: insulin isoform X4 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus 89 1 62.7734 151 8.9024e-11 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 71 gi|744624448|ref|XP_010998519.1| XP_010998519 PREDICTED: insulin, isoform 2-like, partial [Camelus dromedarius] 9838 Camelus dromedarius 183 1 63.929 154 9.39244e-11 26 26 22 49 20 47 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FANQHLCGSHLVEALYLVCGERGFFYTP F NQHLCGSHLVEALYLVCGERGFF TP 72 gi|1034085320|ref|XP_016775240.1| XP_016775240 insulin isoform X1 [Pan troglodytes] 9598 Pan troglodytes 204 1 63.929 154 9.53894e-11 28 28 22 51 119 148 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 73 gi|1392926258|gb|PWQ88787.1| PWQ88787 hypothetical protein DKX15_17460, partial [Enterococcus faecium] 1352 Enterococcus faecium 54 1 61.6178 148 1.11018e-10 28 28 21 51 10 40 31 0 NFVNQHLCGSHLVEALYLVCGERGFFXTPXT RFVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 74 gi|1040079571|gb|OBS57160.1| OBS57160 hypothetical protein A6R68_11716 [Neotoma lepida] 56216 Neotoma lepida 108 1 62.7734 151 1.35672e-10 27 31 14 51 17 54 38 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT WEPKPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKS ++ + FVNQHLCGSHLVEALYLVCGERGFF TP + 75 gi|210060771|pdb|2RN5|B 2RN5_B Chain B, Humal Insulin Mutant B31Lys-B32Arg 9606 Homo sapiens gi|334359037|pdb|2KXK|B 2KXK_B Chain B, Human Insulin Mutant A22Gly-B31Lys-B32Arg 9606 Homo sapiens gi|1345622431|pdb|5MWQ|B 5MWQ_B Chain B, Biosynthetic engineered A21K-B31K-B32R human insulin monomer structure in water/acetonitrile solution 9606 Homo sapiens 32 1 61.2326 147 1.39088e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 76 gi|697351599|pdb|4UNG|B 4UNG_B Chain B, Human Insulin B26asn Mutant Crystal Structure 9606 Homo sapiens gi|697351601|pdb|4UNG|D 4UNG_D Chain D, Human Insulin B26asn Mutant Crystal Structure 9606 Homo sapiens 30 1 60.8474 146 1.53688e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFNTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 77 gi|208664|gb|AAA72171.1| AAA72171 insulin B chain [synthetic construct] 32630 synthetic construct 31 1 60.8474 146 1.60023e-10 28 28 22 51 2 31 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 78 gi|383875273|pdb|2LGB|B 2LGB_B Chain B, Modified A22Gly-B31Arg Human Insulin 9606 Homo sapiens 31 1 60.8474 146 1.70606e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 79 gi|288562787|pdb|2WRX|B 2WRX_B Chain B, Semi-Synthetic Analogue Of Human Insulin Nmealab26-Insulin At Ph 3.0 9606 Homo sapiens gi|288562789|pdb|2WRX|D 2WRX_D Chain D, Semi-Synthetic Analogue Of Human Insulin Nmealab26-Insulin At Ph 3.0 9606 Homo sapiens gi|288562791|pdb|2WS0|B 2WS0_B Chain B, Semi-Synthetic Analogue Of Human Insulin Nmealab26-Insulin At Ph 7.5 9606 Homo sapiens gi|288562793|pdb|2WS1|B 2WS1_B Chain B, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Monomer Form 9606 Homo sapiens gi|288562801|pdb|2WS6|F 2WS6_F Chain F, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562803|pdb|2WS6|H 2WS6_H Chain H, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562805|pdb|2WS6|J 2WS6_J Chain J, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562807|pdb|2WS6|L 2WS6_L Chain L, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens 30 1 60.8474 146 1.72836e-10 29 29 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFXTPKT FVNQHLCGSHLVEALYLVCGERGFFXTP T 80 gi|1069429767|gb|AOR50935.1| AOR50935 mini-insulin, partial [synthetic construct] 32630 synthetic construct 88 1 62.003 149 1.80655e-10 28 28 22 51 8 37 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 81 gi|1191854327|ref|XP_020936937.1| XP_020936937 insulin isoform X1 [Sus scrofa] 9823 Sus scrofa 175 1 63.1586 152 1.87976e-10 27 27 22 49 92 119 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 82 gi|494681|pdb|1TRZ|B 1TRZ_B Chain B, Crystallographic Evidence For Dual Coordination Around Zinc In The T3r3 Human Insulin Hexamer 32630 synthetic construct gi|494683|pdb|1TRZ|D 1TRZ_D Chain D, Crystallographic Evidence For Dual Coordination Around Zinc In The T3r3 Human Insulin Hexamer 32630 synthetic construct gi|640459|pdb|1TYL|B 1TYL_B Chain B, The Structure Of A Complex Of Hexameric Insulin And 4'- Hydroxyacetanilide 9606 Homo sapiens gi|640461|pdb|1TYL|D 1TYL_D Chain D, The Structure Of A Complex Of Hexameric Insulin And 4'- Hydroxyacetanilide 9606 Homo sapiens gi|640463|pdb|1TYM|B 1TYM_B Chain B, The Structure Of A Complex Of Hexameric Insulin And 4'- Hydroxyacetanilide 9606 Homo sapiens gi|640465|pdb|1TYM|D 1TYM_D Chain D, The Structure Of A Complex Of Hexameric Insulin And 4'- Hydroxyacetanilide 9606 Homo sapiens gi|2914283|pdb|1ZNJ|B 1ZNJ_B Chain B, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914285|pdb|1ZNJ|D 1ZNJ_D Chain D, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914287|pdb|1ZNJ|F 1ZNJ_F Chain F, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914289|pdb|1ZNJ|H 1ZNJ_H Chain H, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914291|pdb|1ZNJ|J 1ZNJ_J Chain J, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914293|pdb|1ZNJ|L 1ZNJ_L Chain L, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|11514587|pdb|1FU2|B 1FU2_B Chain B, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514589|pdb|1FU2|D 1FU2_D Chain D, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514591|pdb|1FU2|F 1FU2_F Chain F, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514593|pdb|1FU2|H 1FU2_H Chain H, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514596|pdb|1FUB|B 1FUB_B Chain B, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514598|pdb|1FUB|D 1FUB_D Chain D, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|12084730|pdb|1EV3|B 1EV3_B Chain B, Structure Of The Rhombohedral Form Of The M-cresol/insulin R6 Hexamer 32630 synthetic construct gi|12084732|pdb|1EV3|D 1EV3_D Chain D, Structure Of The Rhombohedral Form Of The M-cresol/insulin R6 Hexamer 32630 synthetic construct gi|12084734|pdb|1EV6|B 1EV6_B Chain B, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084736|pdb|1EV6|D 1EV6_D Chain D, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084738|pdb|1EV6|F 1EV6_F Chain F, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084740|pdb|1EV6|H 1EV6_H Chain H, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084742|pdb|1EV6|J 1EV6_J Chain J, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084744|pdb|1EV6|L 1EV6_L Chain L, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084750|pdb|1EVR|B 1EVR_B Chain B, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084752|pdb|1EVR|D 1EVR_D Chain D, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084754|pdb|1EVR|F 1EVR_F Chain F, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084756|pdb|1EVR|H 1EVR_H Chain H, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084758|pdb|1EVR|J 1EVR_J Chain J, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084760|pdb|1EVR|L 1EVR_L Chain L, The Structure Of The Resorcinol/insulin R6 Hexamer gi|14488704|pdb|1J73|B 1J73_B Chain B, Crystal Structure Of An Unstable Insulin Analog With Native Activity. 32630 synthetic construct gi|14488706|pdb|1J73|D 1J73_D Chain D, Crystal Structure Of An Unstable Insulin Analog With Native Activity. 32630 synthetic construct gi|14719691|pdb|1JCA|B 1JCA_B Chain B, Non-standard Design Of Unstable Insulin Analogues With Enhanced Activity 32630 synthetic construct gi|14719693|pdb|1JCA|D 1JCA_D Chain D, Non-standard Design Of Unstable Insulin Analogues With Enhanced Activity 32630 synthetic construct gi|15825861|pdb|1G7A|H 1G7A_H Chain H, 1.2 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|15825869|pdb|1G7B|H 1G7B_H Chain H, 1.3 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|20149924|pdb|1GUJ|B 1GUJ_B Chain B, Insulin At Ph 2: Structural Analysis Of The Conditions Promoting Insulin Fibre Formation. 9606 Homo sapiens gi|20149926|pdb|1GUJ|D 1GUJ_D Chain D, Insulin At Ph 2: Structural Analysis Of The Conditions Promoting Insulin Fibre Formation. 9606 Homo sapiens gi|34810571|pdb|1Q4V|B 1Q4V_B Chain B, Crystal Structure Of Allo-Ilea2-Insulin, An Inactive Chiral Analogue: Implications For The Mechanism Of Receptor 32630 synthetic construct gi|34810573|pdb|1Q4V|D 1Q4V_D Chain D, Crystal Structure Of Allo-Ilea2-Insulin, An Inactive Chiral Analogue: Implications For The Mechanism Of Receptor 32630 synthetic construct gi|34811013|pdb|1OS3|B 1OS3_B Chain B, Dehydrated T6 Human Insulin At 100 K 9606 Homo sapiens gi|34811015|pdb|1OS3|D 1OS3_D Chain D, Dehydrated T6 Human Insulin At 100 K 9606 Homo sapiens gi|34811017|pdb|1OS4|B 1OS4_B Chain B, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811019|pdb|1OS4|D 1OS4_D Chain D, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811021|pdb|1OS4|F 1OS4_F Chain F, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811023|pdb|1OS4|H 1OS4_H Chain H, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811025|pdb|1OS4|J 1OS4_J Chain J, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811027|pdb|1OS4|L 1OS4_L Chain L, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|47169135|pdb|1SF1|B 1SF1_B Chain B, NMR STRUCTURE OF HUMAN INSULIN under Amyloidogenic Condition, 15 STRUCTURES 9606 Homo sapiens gi|61679822|pdb|1RWE|B 1RWE_B Chain B, Enhancing The Activity Of Insulin At Receptor Edge: Crystal Structure And Photo-Cross-Linking Of A8 Analogues 32630 synthetic construct gi|61679824|pdb|1RWE|D 1RWE_D Chain D, Enhancing The Activity Of Insulin At Receptor Edge: Crystal Structure And Photo-Cross-Linking Of A8 Analogues 32630 synthetic construct gi|66360627|pdb|1XW7|B 1XW7_B Chain B, Diabetes-associated Mutations In Human Insulin: Crystal Structure And Photo-cross-linking Studies Of A-chain Variant Insulin Wakayama gi|66360629|pdb|1XW7|D 1XW7_D Chain D, Diabetes-associated Mutations In Human Insulin: Crystal Structure And Photo-cross-linking Studies Of A-chain Variant Insulin Wakayama gi|118137794|pdb|2G54|C 2G54_C Chain C, Crystal Structure Of Zn-Bound Human Insulin-Degrading Enzyme In Complex With Insulin B Chain 32630 synthetic construct gi|118137795|pdb|2G54|D 2G54_D Chain D, Crystal Structure Of Zn-Bound Human Insulin-Degrading Enzyme In Complex With Insulin B Chain 32630 synthetic construct gi|118137798|pdb|2G56|C 2G56_C Chain C, Crystal Structure Of Human Insulin-degrading Enzyme In Complex With Insulin B Chain 32630 synthetic construct gi|118137799|pdb|2G56|D 2G56_D Chain D, Crystal Structure Of Human Insulin-degrading Enzyme In Complex With Insulin B Chain 32630 synthetic construct gi|145580083|pdb|2OMG|B 2OMG_B Chain B, Structure of human insulin cocrystallized with protamine and urea 9606 Homo sapiens gi|145580085|pdb|2OMG|D 2OMG_D Chain D, Structure of human insulin cocrystallized with protamine and urea 9606 Homo sapiens gi|145580087|pdb|2OMG|F 2OMG_F Chain F, Structure of human insulin cocrystallized with protamine and urea 9606 Homo sapiens gi|145580089|pdb|2OMH|B 2OMH_B Chain B, Structure of human insulin cocrystallized with ARG-12 peptide in presence of urea 9606 Homo sapiens gi|145580091|pdb|2OMH|D 2OMH_D Chain D, Structure of human insulin cocrystallized with ARG-12 peptide in presence of urea 9606 Homo sapiens gi|145580093|pdb|2OMH|F 2OMH_F Chain F, Structure of human insulin cocrystallized with ARG-12 peptide in presence of urea 9606 Homo sapiens gi|145580095|pdb|2OMI|B 2OMI_B Chain B, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580097|pdb|2OMI|D 2OMI_D Chain D, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580099|pdb|2OMI|F 2OMI_F Chain F, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580101|pdb|2OMI|H 2OMI_H Chain H, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580103|pdb|2OMI|J 2OMI_J Chain J, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580105|pdb|2OMI|L 2OMI_L Chain L, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|159162048|pdb|1AI0|B 1AI0_B Chain B, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162050|pdb|1AI0|D 1AI0_D Chain D, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162052|pdb|1AI0|F 1AI0_F Chain F, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162054|pdb|1AI0|H 1AI0_H Chain H, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162056|pdb|1AI0|J 1AI0_J Chain J, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162058|pdb|1AI0|L 1AI0_L Chain L, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162060|pdb|1AIY|B 1AIY_B Chain B, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162062|pdb|1AIY|D 1AIY_D Chain D, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162064|pdb|1AIY|F 1AIY_F Chain F, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162066|pdb|1AIY|H 1AIY_H Chain H, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162068|pdb|1AIY|J 1AIY_J Chain J, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162070|pdb|1AIY|L 1AIY_L Chain L, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159163612|pdb|1XGL|B 1XGL_B Chain B, Human Insulin Disulfide Isomer, Nmr, 10 Structures 9606 Homo sapiens gi|159163730|pdb|2AIY|B 2AIY_B Chain B, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163732|pdb|2AIY|D 2AIY_D Chain D, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163734|pdb|2AIY|F 2AIY_F Chain F, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163736|pdb|2AIY|H 2AIY_H Chain H, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163738|pdb|2AIY|J 2AIY_J Chain J, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163740|pdb|2AIY|L 2AIY_L Chain L, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159164633|pdb|2HIU|B 2HIU_B Chain B, NMR STRUCTURE OF HUMAN INSULIN IN 20% ACETIC ACID, ZINC-FREE, 10 STRUCTURES 9606 Homo sapiens gi|159164858|pdb|3AIY|B 3AIY_B Chain B, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164860|pdb|3AIY|D 3AIY_D Chain D, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164862|pdb|3AIY|F 3AIY_F Chain F, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164864|pdb|3AIY|H 3AIY_H Chain H, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164866|pdb|3AIY|J 3AIY_J Chain J, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164868|pdb|3AIY|L 3AIY_L Chain L, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164883|pdb|4AIY|B 4AIY_B Chain B, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164885|pdb|4AIY|D 4AIY_D Chain D, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164887|pdb|4AIY|F 4AIY_F Chain F, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164889|pdb|4AIY|H 4AIY_H Chain H, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164891|pdb|4AIY|J 4AIY_J Chain J, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164893|pdb|4AIY|L 4AIY_L Chain L, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164896|pdb|5AIY|B 5AIY_B Chain B, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164898|pdb|5AIY|D 5AIY_D Chain D, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164900|pdb|5AIY|F 5AIY_F Chain F, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164902|pdb|5AIY|H 5AIY_H Chain H, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164904|pdb|5AIY|J 5AIY_J Chain J, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164906|pdb|5AIY|L 5AIY_L Chain L, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|161760928|pdb|2OLY|B 2OLY_B Chain B, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760930|pdb|2OLY|D 2OLY_D Chain D, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760932|pdb|2OLY|F 2OLY_F Chain F, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760934|pdb|2OLY|H 2OLY_H Chain H, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760936|pdb|2OLY|J 2OLY_J Chain J, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760938|pdb|2OLY|L 2OLY_L Chain L, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760940|pdb|2OLZ|B 2OLZ_B Chain B, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760942|pdb|2OLZ|D 2OLZ_D Chain D, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760944|pdb|2OLZ|F 2OLZ_F Chain F, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760946|pdb|2OLZ|H 2OLZ_H Chain H, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760948|pdb|2OLZ|J 2OLZ_J Chain J, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760950|pdb|2OLZ|L 2OLZ_L Chain L, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760952|pdb|2OM0|B 2OM0_B Chain B, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760954|pdb|2OM0|D 2OM0_D Chain D, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760956|pdb|2OM0|F 2OM0_F Chain F, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760958|pdb|2OM0|H 2OM0_H Chain H, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760960|pdb|2OM0|J 2OM0_J Chain J, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760962|pdb|2OM0|L 2OM0_L Chain L, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760964|pdb|2OM0|R 2OM0_R Chain R, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760966|pdb|2OM0|T 2OM0_T Chain T, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760968|pdb|2OM0|V 2OM0_V Chain V, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760970|pdb|2OM0|Y 2OM0_Y Chain Y, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760972|pdb|2OM0|2 2OM0_2 Chain 2, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760974|pdb|2OM0|4 2OM0_4 Chain 4, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760976|pdb|2OM0|BB 2OM0_BB Chain b, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760978|pdb|2OM0|DD 2OM0_DD Chain d, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760980|pdb|2OM0|FF 2OM0_FF Chain f, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760982|pdb|2OM0|HH 2OM0_HH Chain h, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760984|pdb|2OM0|JJ 2OM0_JJ Chain j, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760986|pdb|2OM0|LL 2OM0_LL Chain l, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760988|pdb|2OM1|B 2OM1_B Chain B, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760990|pdb|2OM1|D 2OM1_D Chain D, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760992|pdb|2OM1|F 2OM1_F Chain F, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760994|pdb|2OM1|H 2OM1_H Chain H, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760996|pdb|2OM1|J 2OM1_J Chain J, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760998|pdb|2OM1|L 2OM1_L Chain L, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761000|pdb|2OM1|R 2OM1_R Chain R, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761002|pdb|2OM1|T 2OM1_T Chain T, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761004|pdb|2OM1|V 2OM1_V Chain V, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761006|pdb|2OM1|Y 2OM1_Y Chain Y, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761008|pdb|2OM1|2 2OM1_2 Chain 2, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761010|pdb|2OM1|4 2OM1_4 Chain 4, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761012|pdb|2OM1|BB 2OM1_BB Chain b, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761014|pdb|2OM1|DD 2OM1_DD Chain d, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761016|pdb|2OM1|FF 2OM1_FF Chain f, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761018|pdb|2OM1|HH 2OM1_HH Chain h, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761020|pdb|2OM1|JJ 2OM1_JJ Chain j, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761022|pdb|2OM1|LL 2OM1_LL Chain l, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|162329912|pdb|2JV1|B 2JV1_B Chain B, NMR structure of human insulin monomer in 35% CD3CN zinc free, 50 structures 9606 Homo sapiens gi|168988696|pdb|2QIU|B 2QIU_B Chain B, Structure Of Human Arg-Insulin 9606 Homo sapiens gi|168988698|pdb|2QIU|D 2QIU_D Chain D, Structure Of Human Arg-Insulin 9606 Homo sapiens gi|197724920|pdb|2R34|B 2R34_B Chain B, Crystal Structure Of Mn Human Arg-Insulin 9606 Homo sapiens gi|197724922|pdb|2R34|D 2R34_D Chain D, Crystal Structure Of Mn Human Arg-Insulin 9606 Homo sapiens gi|197724924|pdb|2R35|B 2R35_B Chain B, Crystal Structure Of Rb Human Arg-Insulin 9606 Homo sapiens gi|197724926|pdb|2R35|D 2R35_D Chain D, Crystal Structure Of Rb Human Arg-Insulin 9606 Homo sapiens gi|197724928|pdb|2R36|B 2R36_B Chain B, Crystal Structure Of Ni Human Arg-Insulin 32630 synthetic construct gi|197724930|pdb|2R36|D 2R36_D Chain D, Crystal Structure Of Ni Human Arg-Insulin 32630 synthetic construct gi|203282270|pdb|2VJZ|B 2VJZ_B Chain B, Crystal Structure Form Ultalente Insulin Microcrystals 9606 Homo sapiens gi|203282272|pdb|2VJZ|D 2VJZ_D Chain D, Crystal Structure Form Ultalente Insulin Microcrystals 9606 Homo sapiens gi|203282274|pdb|2VK0|B 2VK0_B Chain B, Crystal Structure Form Ultalente Insulin Microcrystals 9606 Homo sapiens gi|203282276|pdb|2VK0|D 2VK0_D Chain D, Crystal Structure Form Ultalente Insulin Microcrystals 9606 Homo sapiens gi|225733952|pdb|2WC0|D 2WC0_D Chain D, Crystal Structure Of Human Insulin Degrading Enzyme In Complex With Iodinated Insulin 32630 synthetic construct gi|225733954|pdb|2WC0|F 2WC0_F Chain F, Crystal Structure Of Human Insulin Degrading Enzyme In Complex With Iodinated Insulin 32630 synthetic construct gi|237823824|pdb|3EXX|B 3EXX_B Chain B, Structure Of The T6 Human Insulin Derivative With Nickel At 1.35 A Resolution 9606 Homo sapiens gi|237823826|pdb|3EXX|D 3EXX_D Chain D, Structure Of The T6 Human Insulin Derivative With Nickel At 1.35 A Resolution 9606 Homo sapiens gi|255311788|pdb|3FQ9|B 3FQ9_B Chain B, Design Of An Insulin Analog With Enhanced Receptor-Binding Selectivity. Rationale, Structure, And Therapeutic Implications 32630 synthetic construct gi|255311790|pdb|3FQ9|D 3FQ9_D Chain D, Design Of An Insulin Analog With Enhanced Receptor-Binding Selectivity. Rationale, Structure, And Therapeutic Implications 32630 synthetic construct gi|288562797|pdb|2WS6|B 2WS6_B Chain B, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562799|pdb|2WS6|D 2WS6_D Chain D, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|289526760|pdb|3KQ6|B 3KQ6_B Chain B, Enhancing The Therapeutic Properties Of A Protein By A Desig Binding Site, Structural Principles Of A Novel Long-Acting Analog 9606 Homo sapiens gi|289526762|pdb|3KQ6|D 3KQ6_D Chain D, Enhancing The Therapeutic Properties Of A Protein By A Desig Binding Site, Structural Principles Of A Novel Long-Acting Analog 9606 Homo sapiens gi|302566078|pdb|3ILG|B 3ILG_B Chain B, Crystal Structure Of Humnan Insulin Sr+2 Complex 9606 Homo sapiens gi|302566080|pdb|3ILG|D 3ILG_D Chain D, Crystal Structure Of Humnan Insulin Sr+2 Complex 9606 Homo sapiens gi|303324848|pdb|3INC|B 3INC_B Chain B, Crystal Structure Of Human Insulin With Ni+2 Complex 9606 Homo sapiens gi|303324850|pdb|3INC|D 3INC_D Chain D, Crystal Structure Of Human Insulin With Ni+2 Complex 9606 Homo sapiens gi|305677677|pdb|3IR0|B 3IR0_B Chain B, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677679|pdb|3IR0|D 3IR0_D Chain D, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677681|pdb|3IR0|F 3IR0_F Chain F, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677683|pdb|3IR0|H 3IR0_H Chain H, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677685|pdb|3IR0|J 3IR0_J Chain J, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677687|pdb|3IR0|L 3IR0_L Chain L, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677689|pdb|3IR0|N 3IR0_N Chain N, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677691|pdb|3IR0|P 3IR0_P Chain P, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677693|pdb|3IR0|S 3IR0_S Chain S, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677695|pdb|3IR0|U 3IR0_U Chain U, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677697|pdb|3IR0|W 3IR0_W Chain W, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677699|pdb|3IR0|Y 3IR0_Y Chain Y, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|329666185|pdb|3Q6E|B 3Q6E_B Chain B, Human Insulin In Complex With Cucurbit[7]uril 9606 Homo sapiens gi|329666187|pdb|3Q6E|D 3Q6E_D Chain D, Human Insulin In Complex With Cucurbit[7]uril 9606 Homo sapiens gi|342351235|pdb|3ZU1|B 3ZU1_B Chain B, Structure of LysB29(Nepsilon omega-carboxyheptadecanoyl) des(B30) Human Insulin 9606 Homo sapiens gi|342351237|pdb|3ZU1|D 3ZU1_D Chain D, Structure of LysB29(Nepsilon omega-carboxyheptadecanoyl) des(B30) Human Insulin 9606 Homo sapiens gi|353251897|pdb|3TT8|B 3TT8_B Chain B, Crystal Structure Analysis Of Cu Human Insulin Derivative 9606 Homo sapiens gi|353251899|pdb|3TT8|D 3TT8_D Chain D, Crystal Structure Analysis Of Cu Human Insulin Derivative 9606 Homo sapiens gi|357380866|pdb|1G7A|B 1G7A_B Chain B, 1.2 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|357380868|pdb|1G7A|D 1G7A_D Chain D, 1.2 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|357380870|pdb|1G7A|F 1G7A_F Chain F, 1.2 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|358009481|pdb|3P33|B 3P33_B Chain B, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009483|pdb|3P33|D 3P33_D Chain D, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009485|pdb|3P33|F 3P33_F Chain F, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009487|pdb|3P33|H 3P33_H Chain H, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|407280302|pdb|1G7B|B 1G7B_B Chain B, 1.3 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|407280304|pdb|1G7B|D 1G7B_D Chain D, 1.3 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|407280306|pdb|1G7B|F 1G7B_F Chain F, 1.3 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|429544228|pdb|3V19|B 3V19_B Chain B, Forestalling Insulin Fibrillation By Insertion Of A Chiral Clamp Mechanism-Based Application Of Protein Engineering To Global Health 9606 Homo sapiens gi|429544230|pdb|3V19|D 3V19_D Chain D, Forestalling Insulin Fibrillation By Insertion Of A Chiral Clamp Mechanism-Based Application Of Protein Engineering To Global Health 9606 Homo sapiens gi|440690583|pdb|3W11|B 3W11_B Chain B, Insulin Receptor Ectodomain Construct Comprising Domains L1-cr In Complex With Human Insulin, Alpha-ct Peptide(704-719) And Fab 83-7 9606 Homo sapiens gi|440923776|pdb|1MSO|B 1MSO_B Chain B, T6 Human Insulin At 1.0 A Resolution gi|440923778|pdb|1MSO|D 1MSO_D Chain D, T6 Human Insulin At 1.0 A Resolution gi|449802481|pdb|4FKA|B 4FKA_B Chain B, High Resolution Structure Of The Manganese Derivative Of Insulin 9606 Homo sapiens gi|449802483|pdb|4FKA|D 4FKA_D Chain D, High Resolution Structure Of The Manganese Derivative Of Insulin 9606 Homo sapiens gi|485601705|pdb|4EWW|B 4EWW_B Chain B, Human Insulin 9606 Homo sapiens gi|485601707|pdb|4EWW|D 4EWW_D Chain D, Human Insulin 9606 Homo sapiens gi|485601709|pdb|4EWX|B 4EWX_B Chain B, Human Insulin 9606 Homo sapiens gi|485601711|pdb|4EWX|D 4EWX_D Chain D, Human Insulin 9606 Homo sapiens gi|485601713|pdb|4EWZ|B 4EWZ_B Chain B, Human Insulin 9606 Homo sapiens gi|485601715|pdb|4EWZ|D 4EWZ_D Chain D, Human Insulin 9606 Homo sapiens gi|485601717|pdb|4EX0|B 4EX0_B Chain B, Human Insulin 9606 Homo sapiens gi|485601719|pdb|4EX0|D 4EX0_D Chain D, Human Insulin 9606 Homo sapiens gi|485601721|pdb|4EX1|B 4EX1_B Chain B, Human Insulin 9606 Homo sapiens gi|485601723|pdb|4EX1|D 4EX1_D Chain D, Human Insulin 9606 Homo sapiens gi|485601725|pdb|4EXX|B 4EXX_B Chain B, Human Insulin 9606 Homo sapiens gi|485601727|pdb|4EXX|D 4EXX_D Chain D, Human Insulin 9606 Homo sapiens gi|485601729|pdb|4EY1|B 4EY1_B Chain B, Human Insulin 9606 Homo sapiens gi|485601731|pdb|4EY1|D 4EY1_D Chain D, Human Insulin 9606 Homo sapiens gi|485601733|pdb|4EY9|B 4EY9_B Chain B, Human Insulin 9606 Homo sapiens gi|485601735|pdb|4EY9|D 4EY9_D Chain D, Human Insulin 9606 Homo sapiens gi|485601737|pdb|4EYD|B 4EYD_B Chain B, Human Insulin 9606 Homo sapiens gi|485601739|pdb|4EYD|D 4EYD_D Chain D, Human Insulin 9606 Homo sapiens gi|485601741|pdb|4EYN|B 4EYN_B Chain B, Human Insulin 9606 Homo sapiens gi|485601743|pdb|4EYN|D 4EYN_D Chain D, Human Insulin 9606 Homo sapiens gi|485601745|pdb|4EYP|B 4EYP_B Chain B, Human Insulin 9606 Homo sapiens gi|485601747|pdb|4EYP|D 4EYP_D Chain D, Human Insulin 9606 Homo sapiens gi|491668282|pdb|4F0N|B 4F0N_B Chain B, Human Insulin 9606 Homo sapiens gi|491668284|pdb|4F0N|D 4F0N_D Chain D, Human Insulin 9606 Homo sapiens gi|491668286|pdb|4F0O|B 4F0O_B Chain B, Human Insulin 9606 Homo sapiens gi|491668288|pdb|4F0O|D 4F0O_D Chain D, Human Insulin 9606 Homo sapiens gi|491668292|pdb|4F1A|B 4F1A_B Chain B, Human Insulin 9606 Homo sapiens gi|491668294|pdb|4F1A|D 4F1A_D Chain D, Human Insulin 9606 Homo sapiens gi|491668296|pdb|4F1B|B 4F1B_B Chain B, Human Insulin 9606 Homo sapiens gi|491668298|pdb|4F1B|D 4F1B_D Chain D, Human Insulin 9606 Homo sapiens gi|491668300|pdb|4F1C|B 4F1C_B Chain B, Human Insulin 9606 Homo sapiens gi|491668302|pdb|4F1C|D 4F1C_D Chain D, Human Insulin 9606 Homo sapiens gi|491668304|pdb|4F1D|B 4F1D_B Chain B, Human Insulin 9606 Homo sapiens gi|491668306|pdb|4F1D|D 4F1D_D Chain D, Human Insulin 9606 Homo sapiens gi|491668308|pdb|4F1F|B 4F1F_B Chain B, Human Insulin 9606 Homo sapiens gi|491668310|pdb|4F1F|D 4F1F_D Chain D, Human Insulin 9606 Homo sapiens gi|491668312|pdb|4F1G|B 4F1G_B Chain B, Human Insulin 9606 Homo sapiens gi|491668314|pdb|4F1G|D 4F1G_D Chain D, Human Insulin 9606 Homo sapiens gi|499141951|pdb|4F4T|B 4F4T_B Chain B, Human Insulin 9606 Homo sapiens gi|499141953|pdb|4F4T|D 4F4T_D Chain D, Human Insulin 9606 Homo sapiens gi|499141955|pdb|4F4V|B 4F4V_B Chain B, Human Insulin 9606 Homo sapiens gi|499141957|pdb|4F4V|D 4F4V_D Chain D, Human Insulin 9606 Homo sapiens gi|499141959|pdb|4F51|B 4F51_B Chain B, Human Insulin 9606 Homo sapiens gi|499141961|pdb|4F51|D 4F51_D Chain D, Human Insulin 9606 Homo sapiens gi|507043036|pdb|4F8F|B 4F8F_B Chain B, Human Insulin 9606 Homo sapiens gi|507043038|pdb|4F8F|D 4F8F_D Chain D, Human Insulin 9606 Homo sapiens gi|512125453|pdb|4FG3|B 4FG3_B Chain B, Crystal Structure Analysis of the Human Insulin 9606 Homo sapiens gi|512125455|pdb|4FG3|D 4FG3_D Chain D, Crystal Structure Analysis of the Human Insulin 9606 Homo sapiens gi|520728517|pdb|3W7Y|B 3W7Y_B Chain B, 0.92A structure of 2Zn human insulin at 100K 9606 Homo sapiens gi|520728519|pdb|3W7Y|D 3W7Y_D Chain D, 0.92A structure of 2Zn human insulin at 100K 9606 Homo sapiens gi|520728521|pdb|3W7Z|B 3W7Z_B Chain B, 1.15A structure of human 2Zn insulin at 293K 9606 Homo sapiens gi|520728523|pdb|3W7Z|D 3W7Z_D Chain D, 1.15A structure of human 2Zn insulin at 293K 9606 Homo sapiens gi|520728525|pdb|3W80|B 3W80_B Chain B, Crystal structure of dodecamer human insulin with double C-axis length of the hexamer 2 Zn insulin cell 9606 Homo sapiens gi|520728527|pdb|3W80|D 3W80_D Chain D, Crystal structure of dodecamer human insulin with double C-axis length of the hexamer 2 Zn insulin cell 9606 Homo sapiens gi|520728529|pdb|3W80|F 3W80_F Chain F, Crystal structure of dodecamer human insulin with double C-axis length of the hexamer 2 Zn insulin cell 9606 Homo sapiens gi|520728531|pdb|3W80|H 3W80_H Chain H, Crystal structure of dodecamer human insulin with double C-axis length of the hexamer 2 Zn insulin cell 9606 Homo sapiens gi|675082469|pdb|4OGA|B 4OGA_B Chain B, Insulin in complex with Site 1 of the human insulin receptor 9606 Homo sapiens gi|731187696|pdb|2MVC|B 2MVC_B Chain B, Solution structure of human insulin at pH 1.9 gi|749197382|pdb|4RXW|B 4RXW_B Chain B, Crystal Structure Of The Cobalt Human Insulin Derivative 9606 Homo sapiens gi|749197384|pdb|4RXW|D 4RXW_D Chain D, Crystal Structure Of The Cobalt Human Insulin Derivative 9606 Homo sapiens gi|756143077|pdb|4XC4|B 4XC4_B Chain B, Insulin co-crystallizes in the presence of it beta-cell chaperone sulfatide 9606 Homo sapiens gi|756143079|pdb|4XC4|D 4XC4_D Chain D, Insulin co-crystallizes in the presence of it beta-cell chaperone sulfatide 9606 Homo sapiens gi|922665161|pdb|5CNY|B 5CNY_B Chain B, Crystal Structure Of Human Zinc Insulin At Ph 5.5 9606 Homo sapiens gi|922665163|pdb|5CNY|D 5CNY_D Chain D, Crystal Structure Of Human Zinc Insulin At Ph 5.5 9606 Homo sapiens gi|922665165|pdb|5CO2|B 5CO2_B Chain B, Crystalization Of Human Zinc Insulin At Ph 5.5 9606 Homo sapiens gi|922665167|pdb|5CO2|D 5CO2_D Chain D, Crystalization Of Human Zinc Insulin At Ph 5.5 9606 Homo sapiens gi|922665169|pdb|5CO6|B 5CO6_B Chain B, Crystal Structure Of Human Zinc Insulin At Ph 6.5 9606 Homo sapiens gi|922665171|pdb|5CO6|D 5CO6_D Chain D, Crystal Structure Of Human Zinc Insulin At Ph 6.5 9606 Homo sapiens gi|922665173|pdb|5CO9|B 5CO9_B Chain B, Crystal Structure Of Human Zinc Insulin At Ph 6.5 9606 Homo sapiens gi|922665175|pdb|5CO9|D 5CO9_D Chain D, Crystal Structure Of Human Zinc Insulin At Ph 6.5 9606 Homo sapiens gi|973744417|pdb|5EN9|B 5EN9_B Chain B, High Resolution X-ray Crystal Structure Of Isotope-labeled Ester- Insulin 9606 Homo sapiens gi|973744419|pdb|5ENA|B 5ENA_B Chain B, Xray Crystal Structure Of Isotope-labeled Human Insulin 9606 Homo sapiens gi|1004171561|pdb|5BTS|B 5BTS_B Chain B, Structural And Biophysical Characterization Of A Covalent Insulin Dimer Formed During Storage Of Neutral Formulation Of Human Insulin 9606 Homo sapiens gi|1080154852|pdb|5E7W|B 5E7W_B Chain B, X-ray Structure of Human Recombinant 2Zn insulin at 0.92 Angstrom 9606 Homo sapiens gi|1080154854|pdb|5E7W|D 5E7W_D Chain D, X-ray Structure of Human Recombinant 2Zn insulin at 0.92 Angstrom 9606 Homo sapiens gi|1175128707|pdb|5MAM|B 5MAM_B Chain B, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128709|pdb|5MAM|D 5MAM_D Chain D, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128711|pdb|5MAM|F 5MAM_F Chain F, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128713|pdb|5MAM|H 5MAM_H Chain H, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128715|pdb|5MAM|J 5MAM_J Chain J, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128717|pdb|5MAM|L 5MAM_L Chain L, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128719|pdb|5MAM|N 5MAM_N Chain N, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128721|pdb|5MAM|P 5MAM_P Chain P, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128723|pdb|5MAM|R 5MAM_R Chain R, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128725|pdb|5MAM|T 5MAM_T Chain T, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128727|pdb|5MAM|V 5MAM_V Chain V, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128729|pdb|5MAM|X 5MAM_X Chain X, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128731|pdb|5MAM|Z 5MAM_Z Chain Z, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128733|pdb|5MAM|1 5MAM_1 Chain 1, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128735|pdb|5MAM|3 5MAM_3 Chain 3, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128737|pdb|5MAM|5 5MAM_5 Chain 5, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128773|pdb|5MT3|B 5MT3_B Chain B, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128775|pdb|5MT3|D 5MT3_D Chain D, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128777|pdb|5MT3|F 5MT3_F Chain F, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128779|pdb|5MT3|H 5MT3_H Chain H, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128781|pdb|5MT3|J 5MT3_J Chain J, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128783|pdb|5MT3|L 5MT3_L Chain L, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128785|pdb|5MT3|N 5MT3_N Chain N, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128787|pdb|5MT3|P 5MT3_P Chain P, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128789|pdb|5MT3|R 5MT3_R Chain R, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128791|pdb|5MT3|T 5MT3_T Chain T, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128793|pdb|5MT3|V 5MT3_V Chain V, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128795|pdb|5MT3|X 5MT3_X Chain X, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128797|pdb|5MT3|Z 5MT3_Z Chain Z, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128799|pdb|5MT3|BB 5MT3_BB Chain b, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128801|pdb|5MT3|DD 5MT3_DD Chain d, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128803|pdb|5MT3|FF 5MT3_FF Chain f, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128805|pdb|5MT9|B 5MT9_B Chain B, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128807|pdb|5MT9|D 5MT9_D Chain D, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128809|pdb|5MT9|F 5MT9_F Chain F, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128811|pdb|5MT9|H 5MT9_H Chain H, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128813|pdb|5MT9|J 5MT9_J Chain J, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128815|pdb|5MT9|L 5MT9_L Chain L, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128817|pdb|5MT9|N 5MT9_N Chain N, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128819|pdb|5MT9|P 5MT9_P Chain P, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128821|pdb|5MT9|R 5MT9_R Chain R, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128823|pdb|5MT9|T 5MT9_T Chain T, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128825|pdb|5MT9|V 5MT9_V Chain V, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128827|pdb|5MT9|X 5MT9_X Chain X, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128829|pdb|5MT9|Z 5MT9_Z Chain Z, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128831|pdb|5MT9|BB 5MT9_BB Chain b, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128833|pdb|5MT9|DD 5MT9_DD Chain d, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128835|pdb|5MT9|FF 5MT9_FF Chain f, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1304111280|pdb|5T7R|B 5T7R_B Chain B, A6-A11 trans-dicarba human insulin gi|1304111282|pdb|5T7R|D 5T7R_D Chain D, A6-A11 trans-dicarba human insulin gi|208660|gb|AAA72917.1| AAA72917 insulin beta chain, partial [synthetic construct] 32630 synthetic construct gi|223126|prf||0510475A 0510475A insulin B,24/25-Leu 9606 Homo sapiens 30 1 60.8474 146 1.90261e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 83 gnl|mdb|bmrb1015:1 bmrb1015:1 insulin B chain 30 1 60.8474 146 1.90261e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 84 gnl|mdb|bmrb1025:1 bmrb1025:1 insulin B chain 30 1 60.8474 146 1.90261e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 85 gnl|mdb|bmrb1633:1 bmrb1633:1 insulin B chain 30 1 60.8474 146 1.90261e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 86 gnl|mdb|bmrb555:1 bmrb555:1 insulin B chain 30 1 60.8474 146 1.90261e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 87 gnl|mdb|bmrb557:1 bmrb557:1 insulin B chain 30 1 60.8474 146 1.90261e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 88 gi|697351603|pdb|4UNH|B 4UNH_B Chain B, Human Insulin B26gly Mutant Crystal Structure 9606 Homo sapiens 30 1 60.8474 146 2.0069e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFGTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 89 gi|697351595|pdb|4UNE|B 4UNE_B Chain B, Human insulin B26Phe mutant crystal structure gi|697351597|pdb|4UNE|D 4UNE_D Chain D, Human insulin B26Phe mutant crystal structure 30 1 60.8474 146 2.0069e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFFTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 90 gi|635011292|ref|XP_008002752.1| XP_008002752 PREDICTED: insulin isoform X1 [Chlorocebus sabaeus] 60711 Chlorocebus sabaeus 209 1 63.1586 152 2.03957e-10 28 28 22 51 124 153 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 91 gi|1099101085|ref|XP_018891846.1| XP_018891846 PREDICTED: insulin isoform X2 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla gi|114318995|gb|ABI63346.1| ABI63346 insulin [Homo sapiens] 9606 Homo sapiens 98 1 62.003 149 2.22115e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 92 gi|675736160|ref|XP_008967348.1| XP_008967348 insulin isoform X2 [Pan paniscus] 9597 Pan paniscus 98 1 62.003 149 2.24451e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 93 gi|1351394473|ref|XP_024110668.1| XP_024110668 insulin isoform X3 [Pongo abelii] 9601 Pongo abelii gi|1331868171|gb|PNJ16423.1| PNJ16423 INS isoform 5 [Pongo abelii] 9601 Pongo abelii 98 1 62.003 149 2.29195e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 94 gi|795558862|ref|XP_011719621.1| XP_011719621 insulin isoform X2 [Macaca nemestrina] 9545 Macaca nemestrina gi|820983809|ref|XP_012352084.1| XP_012352084 PREDICTED: insulin isoform X3 [Nomascus leucogenys] 61853 Nomascus leucogenys 98 1 62.003 149 2.38987e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 95 gi|452814811|gb|AGG11869.1| AGG11869 HPPI [synthetic construct] 32630 synthetic construct 97 1 62.003 149 2.39938e-10 28 28 21 51 11 41 31 0 NFVNQHLCGSHLVEALYLVCGERGFFXTPXT RFVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 96 gi|3127060|gb|AAC78289.1| AAC78289 proinsulin-like protein BKRA [synthetic construct] 32630 synthetic construct 54 1 60.8474 146 2.59916e-10 28 28 22 51 2 31 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 97 gi|985483654|pdb|2N2V|B 2N2V_B Chain B, Solution structure of [B26-B29 triazole cross-linked]-insulin analogue at pH 1.9 gi|985483656|pdb|2N2W|B 2N2W_B Chain B, Solution structure of [B26-B29 triazole cross-linked]-insulin analogue at pH 8.0 gi|1103700631|pdb|5EMS|B 5EMS_B Chain B, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700633|pdb|5EMS|D 5EMS_D Chain D, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700635|pdb|5EMS|F 5EMS_F Chain F, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700637|pdb|5EMS|H 5EMS_H Chain H, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700639|pdb|5EMS|J 5EMS_J Chain J, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700641|pdb|5EMS|L 5EMS_L Chain L, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens 30 1 60.4622 145 2.62046e-10 30 30 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFXTPXT 98 gi|795176058|ref|XP_011843618.1| XP_011843618 PREDICTED: insulin isoform X2 [Mandrillus leucophaeus] 9568 Mandrillus leucophaeus gi|795357486|ref|XP_011785466.1| XP_011785466 PREDICTED: insulin isoform X3 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus gi|1059087103|ref|XP_017743300.1| XP_017743300 PREDICTED: insulin isoform X3 [Rhinopithecus bieti] 61621 Rhinopithecus bieti gi|1297703555|ref|XP_023039288.1| XP_023039288 insulin isoform X3 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles 98 1 61.6178 148 2.68117e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 99 gi|1187570231|ref|XP_020738945.1| XP_020738945 tyrosine 3-monooxygenase isoform X1 [Odocoileus virginianus texanus] 9880 Odocoileus virginianus texanus 574 1 65.4698 158 2.72999e-10 27 27 22 49 494 521 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 100 gi|823670710|gb|AKI70566.1| AKI70566 INS, partial [synthetic construct] 32630 synthetic construct 110 1 62.003 149 2.9287e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 101 gi|1060530993|ref|XP_017803627.1| XP_017803627 insulin isoform X1 [Papio anubis] 9555 Papio anubis 147 1 62.3882 150 2.9625e-10 28 31 14 51 54 91 38 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT WGPDSVPAFVNQHLCGSHLVEALYLVCGERGFFYTPKT + ++ FVNQHLCGSHLVEALYLVCGERGFF TP T 102 gi|307072|gb|AAA59179.1| AAA59179 insulin [Homo sapiens] 9606 Homo sapiens 107 1 61.6178 148 3.07059e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 103 gi|159162253|pdb|1EFE|A 1EFE_A Chain A, An Active Mini-Proinsulin, M2pi 9606 Homo sapiens 60 1 60.8474 146 3.08912e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 104 gi|585686013|ref|XP_006893274.1| XP_006893274 PREDICTED: insulin [Elephantulus edwardii] 28737 Elephantulus edwardii 105 1 61.6178 148 3.10195e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 105 gi|333826819|gb|AEG19452.1| AEG19452 insulin, partial [Homo sapiens] 9606 Homo sapiens 94 1 61.6178 148 3.12034e-10 28 28 22 51 9 38 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 106 gi|57113877|ref|NP_001008996.1| NP_001008996 insulin preproprotein [Pan troglodytes] 9598 Pan troglodytes gi|266377|sp|P30410.1|INS_PANTR P30410 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9598 Pan troglodytes gi|38252|emb|CAA43403.1| CAA43403 Preproinsulin [Pan troglodytes] 9598 Pan troglodytes gi|22901134|gb|AAN06933.1| AAN06933 insulin precursor [Pan troglodytes] 9598 Pan troglodytes 110 1 61.6178 148 3.14943e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 107 gi|4557671|ref|NP_000198.1| NP_000198 insulin preproprotein [Homo sapiens] 9606 Homo sapiens gi|297374821|ref|NP_001172026.1| NP_001172026 insulin preproprotein [Homo sapiens] 9606 Homo sapiens gi|297374823|ref|NP_001172027.1| NP_001172027 insulin preproprotein [Homo sapiens] 9606 Homo sapiens gi|631226408|ref|NP_001278826.1| NP_001278826 insulin preproprotein [Homo sapiens] 9606 Homo sapiens gi|426366889|ref|XP_004050475.1| XP_004050475 PREDICTED: insulin isoform X1 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla gi|426366891|ref|XP_004050476.1| XP_004050476 PREDICTED: insulin isoform X1 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla gi|1099101076|ref|XP_018891845.1| XP_018891845 PREDICTED: insulin isoform X1 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla gi|124617|sp|P01308.1|INS_HUMAN P01308 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9606 Homo sapiens gi|52000618|sp|Q6YK33.1|INS_GORGO Q6YK33 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9595 Gorilla gorilla gorilla gi|1285033482|pdb|6B3Q|AA 6B3Q_AA Chain a, Cryo-EM structure of human insulin degrading enzyme in complex with insulin 9606 Homo sapiens gi|1285033483|pdb|6B3Q|BB 6B3Q_BB Chain b, Cryo-EM structure of human insulin degrading enzyme in complex with insulin 9606 Homo sapiens gi|1321392014|pdb|6B70|AA 6B70_AA Chain a, Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy chain, FAB H11-E light chain and insulin 9606 Homo sapiens gi|1321392015|pdb|6B70|CC 6B70_CC Chain c, Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy chain, FAB H11-E light chain and insulin 9606 Homo sapiens gi|1321392076|pdb|6BFC|AA 6BFC_AA Chain a, Cryo-EM structure of human insulin degrading enzyme in complex with insulin 9606 Homo sapiens gi|1321392077|pdb|6BFC|BB 6BFC_BB Chain b, Cryo-EM structure of human insulin degrading enzyme in complex with insulin 9606 Homo sapiens gi|386828|gb|AAA59172.1| AAA59172 insulin [Homo sapiens] 9606 Homo sapiens gi|386829|gb|AAA59173.1| AAA59173 insulin [Homo sapiens] 9606 Homo sapiens gi|394766|emb|CAA49913.1| CAA49913 pre-proinsulin [Homo sapiens] 9606 Homo sapiens gi|758088|emb|CAA23828.1| CAA23828 preproinsulin [Homo sapiens] 9606 Homo sapiens gi|13528924|gb|AAH05255.1| AAH05255 Insulin [Homo sapiens] 9606 Homo sapiens gi|22901140|gb|AAN06935.1| AAN06935 insulin precursor [Gorilla gorilla] 9593 Gorilla gorilla gi|23986711|gb|AAN39451.1| AAN39451 insulin [Homo sapiens] 9606 Homo sapiens gi|30582455|gb|AAP35454.1| AAP35454 insulin [Homo sapiens] 9606 Homo sapiens gi|59036749|gb|AAW83741.1| AAW83741 proinsulin [Homo sapiens] 9606 Homo sapiens gi|61361296|gb|AAX42025.1| AAX42025 insulin [synthetic construct] 32630 synthetic construct gi|61361299|gb|AAX42026.1| AAX42026 insulin [synthetic construct] 32630 synthetic construct gi|119622893|gb|EAX02488.1| EAX02488 insulin, isoform CRA_a [Homo sapiens] 9606 Homo sapiens gi|119622894|gb|EAX02489.1| EAX02489 insulin, isoform CRA_a [Homo sapiens] 9606 Homo sapiens gi|123992113|gb|ABM83966.1| ABM83966 insulin [synthetic construct] 32630 synthetic construct gi|123999448|gb|ABM87282.1| ABM87282 insulin, partial [synthetic construct] 32630 synthetic construct gi|306921727|dbj|BAJ17943.1| BAJ17943 insulin, partial [synthetic construct] 32630 synthetic construct gi|389620191|gb|AFK93533.1| AFK93533 preproinsulin [Homo sapiens] 9606 Homo sapiens gi|649100983|gb|AIC49067.1| AIC49067 INS, partial [synthetic construct] 32630 synthetic construct gi|1147671168|emb|SJX25028.1| SJX25028 unnamed protein product, partial [Human ORFeome Gateway entry vector] 1958742 Human ORFeome Gateway entry vector gi|223160|prf||0601246A 0601246A insulin,prepro 9606 Homo sapiens 110 1 61.6178 148 3.14943e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 108 gi|675736150|ref|XP_008967344.1| XP_008967344 insulin isoform X1 [Pan paniscus] 9597 Pan paniscus gi|675736152|ref|XP_008967345.1| XP_008967345 insulin isoform X1 [Pan paniscus] 9597 Pan paniscus gi|675736156|ref|XP_008967347.1| XP_008967347 insulin isoform X1 [Pan paniscus] 9597 Pan paniscus 110 1 61.6178 148 3.14943e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 109 gi|58103|emb|CAA23424.1| CAA23424 unnamed protein product [synthetic construct] 32630 synthetic construct gi|208670|gb|AAA72531.1| AAA72531 proinsulin [synthetic construct] 32630 synthetic construct gi|237679346|dbj|BAH59081.1| BAH59081 human M-proinsulin [synthetic construct] 32630 synthetic construct 87 1 61.2326 147 3.16309e-10 28 28 22 51 2 31 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 110 gi|826315417|ref|XP_012507423.1| XP_012507423 PREDICTED: insulin [Propithecus coquereli] 379532 Propithecus coquereli 110 1 61.6178 148 3.18229e-10 29 30 14 51 17 54 38 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT WGPEPAPAFVNQHLCGSHLVEALYLVCGERGFFYTPKT + E FVNQHLCGSHLVEALYLVCGERGFF TP T 111 gi|562822570|ref|XP_006141129.1| XP_006141129 PREDICTED: insulin [Tupaia chinensis] 246437 Tupaia chinensis gi|444731569|gb|ELW71922.1| ELW71922 Insulin [Tupaia chinensis] 246437 Tupaia chinensis 110 1 61.6178 148 3.18229e-10 29 30 14 51 17 54 38 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT WGPEPAPAFVNQHLCGSHLVEALYLVCGERGFFYTPKT + E FVNQHLCGSHLVEALYLVCGERGFF TP T 112 gi|30584395|gb|AAP36446.1| AAP36446 Homo sapiens insulin, partial [synthetic construct] 32630 synthetic construct gi|60653573|gb|AAX29480.1| AAX29480 insulin, partial [synthetic construct] 32630 synthetic construct gi|60653575|gb|AAX29481.1| AAX29481 insulin, partial [synthetic construct] 32630 synthetic construct 111 1 61.6178 148 3.23061e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 113 gi|145694407|gb|ABP93829.1| ABP93829 mini-proinsulin, partial [synthetic construct] 32630 synthetic construct 59 1 60.8474 146 3.23224e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 114 gi|548960961|ref|NP_001271848.1| NP_001271848 insulin precursor [Macaca fascicularis] 9541 Macaca fascicularis gi|332264759|ref|XP_003281399.1| XP_003281399 PREDICTED: insulin isoform X2 [Nomascus leucogenys] 61853 Nomascus leucogenys gi|441609417|ref|XP_004087913.1| XP_004087913 PREDICTED: insulin isoform X2 [Nomascus leucogenys] 61853 Nomascus leucogenys gi|795558843|ref|XP_011719618.1| XP_011719618 insulin isoform X1 [Macaca nemestrina] 9545 Macaca nemestrina gi|795558852|ref|XP_011719619.1| XP_011719619 insulin isoform X1 [Macaca nemestrina] 9545 Macaca nemestrina gi|795558859|ref|XP_011719620.1| XP_011719620 insulin isoform X1 [Macaca nemestrina] 9545 Macaca nemestrina gi|820983807|ref|XP_012352077.1| XP_012352077 PREDICTED: insulin isoform X2 [Nomascus leucogenys] 61853 Nomascus leucogenys gi|982292204|ref|XP_015289666.1| XP_015289666 PREDICTED: insulin isoform X1 [Macaca fascicularis] 9541 Macaca fascicularis gi|266373|sp|P30406.1|INS_MACFA P30406 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9541 Macaca fascicularis gi|342122|gb|AAA36849.1| AAA36849 preproinsulin [Macaca fascicularis] 9541 Macaca fascicularis 110 1 61.6178 148 3.24903e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 115 gi|344307503|ref|XP_003422420.1| XP_003422420 insulin [Loxodonta africana] 9785 Loxodonta africana 105 1 61.6178 148 3.26768e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 116 gi|820983801|ref|XP_003281396.2| XP_003281396 PREDICTED: insulin isoform X1 [Nomascus leucogenys] 61853 Nomascus leucogenys 134 1 62.003 149 3.27879e-10 28 28 22 51 49 78 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 117 gi|1351394461|ref|XP_024110665.1| XP_024110665 insulin isoform X2 [Pongo abelii] 9601 Pongo abelii gi|1351394465|ref|XP_024110666.1| XP_024110666 insulin isoform X2 [Pongo abelii] 9601 Pongo abelii gi|1351394469|ref|XP_024110667.1| XP_024110667 insulin isoform X2 [Pongo abelii] 9601 Pongo abelii gi|48428254|sp|Q8HXV2.1|INS_PONPY Q8HXV2 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9600 Pongo pygmaeus gi|22901146|gb|AAN06937.1| AAN06937 insulin precursor [Pongo pygmaeus] 9600 Pongo pygmaeus gi|1331868167|gb|PNJ16419.1| PNJ16419 INS isoform 1 [Pongo abelii] 9601 Pongo abelii gi|1331868168|gb|PNJ16420.1| PNJ16420 INS isoform 2 [Pongo abelii] 9601 Pongo abelii gi|1331868169|gb|PNJ16421.1| PNJ16421 INS isoform 3 [Pongo abelii] 9601 Pongo abelii 110 1 61.6178 148 3.28293e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 118 gi|402892446|ref|XP_003909425.1| XP_003909425 insulin isoform X2 [Papio anubis] 9555 Papio anubis gi|685584562|ref|XP_009183614.1| XP_009183614 insulin isoform X2 [Papio anubis] 9555 Papio anubis 110 1 61.6178 148 3.28293e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 119 gi|1037236141|gb|ANK79259.1| ANK79259 single chain insulin analog SCI59 [synthetic construct] 32630 synthetic construct 60 1 60.8474 146 3.29214e-10 28 28 22 51 2 31 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 120 gi|586460431|ref|XP_006860871.1| XP_006860871 PREDICTED: insulin [Chrysochloris asiatica] 185453 Chrysochloris asiatica 106 1 61.6178 148 3.31958e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 121 gi|471415841|ref|XP_004389446.1| XP_004389446 insulin [Trichechus manatus latirostris] 127582 Trichechus manatus latirostris 106 1 61.6178 148 3.31958e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 122 gi|795176042|ref|XP_011843615.1| XP_011843615 PREDICTED: insulin isoform X1 [Mandrillus leucophaeus] 9568 Mandrillus leucophaeus gi|795176048|ref|XP_011843616.1| XP_011843616 PREDICTED: insulin isoform X1 [Mandrillus leucophaeus] 9568 Mandrillus leucophaeus gi|795176053|ref|XP_011843617.1| XP_011843617 PREDICTED: insulin isoform X1 [Mandrillus leucophaeus] 9568 Mandrillus leucophaeus gi|795357474|ref|XP_011785464.1| XP_011785464 PREDICTED: insulin isoform X2 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus gi|795357480|ref|XP_011785465.1| XP_011785465 PREDICTED: insulin isoform X2 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus gi|1059087094|ref|XP_017743276.1| XP_017743276 PREDICTED: insulin isoform X1 [Rhinopithecus bieti] 61621 Rhinopithecus bieti gi|1059087096|ref|XP_017743284.1| XP_017743284 PREDICTED: insulin isoform X1 [Rhinopithecus bieti] 61621 Rhinopithecus bieti gi|1059087101|ref|XP_017743293.1| XP_017743293 PREDICTED: insulin isoform X1 [Rhinopithecus bieti] 61621 Rhinopithecus bieti gi|266362|sp|P30407.1|INS_CHLAE P30407 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9534 Chlorocebus aethiops gi|22809|emb|CAA43405.1| CAA43405 Preproinsulin [Chlorocebus aethiops] 9534 Chlorocebus aethiops 110 1 61.6178 148 3.49383e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 123 gi|823670712|gb|AKI70567.1| AKI70567 INS, partial [synthetic construct] 32630 synthetic construct 110 1 61.6178 148 3.53027e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 124 gi|795499563|ref|XP_011896559.1| XP_011896559 PREDICTED: insulin [Cercocebus atys] 9531 Cercocebus atys gi|795499568|ref|XP_011896561.1| XP_011896561 PREDICTED: insulin [Cercocebus atys] 9531 Cercocebus atys gi|795499573|ref|XP_011896562.1| XP_011896562 PREDICTED: insulin [Cercocebus atys] 9531 Cercocebus atys 110 1 61.6178 148 3.67986e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 125 gi|223965|prf||1006230A 1006230A insulin,pro- 9544 Macaca mulatta 86 1 61.2326 147 3.71475e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 126 gi|1297703549|ref|XP_023039285.1| XP_023039285 insulin isoform X1 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles gi|1297703551|ref|XP_023039286.1| XP_023039286 insulin isoform X1 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles 110 1 61.6178 148 3.71823e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 127 gi|208668|gb|AAA72172.1| AAA72172 synthetic preproinsulin [synthetic construct] 32630 synthetic construct 114 1 61.6178 148 3.78399e-10 28 28 22 51 29 58 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 128 gi|966983386|ref|XP_014968840.1| XP_014968840 PREDICTED: insulin [Macaca mulatta] 9544 Macaca mulatta 147 1 62.003 149 3.85227e-10 28 28 22 51 62 91 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 129 gi|635011294|ref|XP_008002825.1| XP_008002825 PREDICTED: insulin isoform X2 [Chlorocebus sabaeus] 60711 Chlorocebus sabaeus 144 1 62.003 149 3.86373e-10 28 28 22 51 59 88 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 130 gi|823670708|gb|AKI70565.1| AKI70565 INS, partial [synthetic construct] 32630 synthetic construct 110 1 61.6178 148 3.957e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 131 gi|1214628408|gb|ASJ76983.1| ASJ76983 single chain insulin analog SCI59 [synthetic construct] 32630 synthetic construct 60 1 60.4622 145 3.98467e-10 28 28 22 51 2 31 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 132 gi|1059087099|ref|XP_017743290.1| XP_017743290 PREDICTED: insulin isoform X2 [Rhinopithecus bieti] 61621 Rhinopithecus bieti 147 1 62.003 149 4.34828e-10 28 28 22 51 62 91 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 133 gi|32171947|sp|P01316.1|INS_ELEMA P01316 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9783 Elephas maximus gi|69307|pir||INEL INEL insulin - elephant 9781 Elephantidae gen. sp. 51 1 60.077 144 4.37715e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 134 gi|724917367|ref|XP_010380355.1| XP_010380355 PREDICTED: insulin [Rhinopithecus roxellana] 61622 Rhinopithecus roxellana 110 1 61.2326 147 4.43515e-10 28 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 135 gi|1297703553|ref|XP_023039287.1| XP_023039287 insulin isoform X2 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles 147 1 62.003 149 4.57326e-10 28 28 22 51 62 91 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFF TP T 136 gi|443060|pdb|1IZA|B 1IZA_B Chain B, Role Of B13 Glu In Insulin Assembly: The Hexamer Structure Of Recombinant Mutant (B13 Glu-> Gln) Insulin 9823 Sus scrofa gi|443062|pdb|1IZA|D 1IZA_D Chain D, Role Of B13 Glu In Insulin Assembly: The Hexamer Structure Of Recombinant Mutant (B13 Glu-> Gln) Insulin 9823 Sus scrofa gi|443064|pdb|1IZB|B 1IZB_B Chain B, Role Of B13 Glu In Insulin Assembly: The Hexamer Structure Of Recombinant Mutant (B13 Glu-> Gln) Insulin 9823 Sus scrofa gi|443066|pdb|1IZB|D 1IZB_D Chain D, Role Of B13 Glu In Insulin Assembly: The Hexamer Structure Of Recombinant Mutant (B13 Glu-> Gln) Insulin 9823 Sus scrofa 30 1 59.6918 143 4.91647e-10 27 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVQALYLVCGERGFFYTPKT FVNQHLCGSHLV+ALYLVCGERGFF TP T 137 gi|1279526625|pdb|5WDM|A 5WDM_A Chain A, An ultra-stable single-chain insulin analog resists thermal inactivation and exhibits biological signaling duration equivalent to the native protein gi|1279526626|pdb|5WDM|B 5WDM_B Chain B, An ultra-stable single-chain insulin analog resists thermal inactivation and exhibits biological signaling duration equivalent to the native protein gi|1279526627|pdb|5WDM|C 5WDM_C Chain C, An ultra-stable single-chain insulin analog resists thermal inactivation and exhibits biological signaling duration equivalent to the native protein gi|1279526628|pdb|5WDM|D 5WDM_D Chain D, An ultra-stable single-chain insulin analog resists thermal inactivation and exhibits biological signaling duration equivalent to the native protein gi|1279526629|pdb|5WDM|E 5WDM_E Chain E, An ultra-stable single-chain insulin analog resists thermal inactivation and exhibits biological signaling duration equivalent to the native protein gi|1279526630|pdb|5WDM|F 5WDM_F Chain F, An ultra-stable single-chain insulin analog resists thermal inactivation and exhibits biological signaling duration equivalent to the native protein 57 1 60.077 144 5.76728e-10 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPET FVNQHLCGSHLVEALYLVCGERGFF TP T 138 gi|507540541|ref|XP_004654275.1| XP_004654275 PREDICTED: insulin [Jaculus jaculus] 51337 Jaculus jaculus 110 1 60.8474 146 5.92844e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 139 gi|61680182|pdb|1W8P|B 1W8P_B Chain B, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680184|pdb|1W8P|D 1W8P_D Chain D, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680186|pdb|1W8P|F 1W8P_F Chain F, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680188|pdb|1W8P|H 1W8P_H Chain H, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680190|pdb|1W8P|J 1W8P_J Chain J, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680192|pdb|1W8P|L 1W8P_L Chain L, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens 30 1 59.3066 142 6.15e-10 27 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFYFTPKT FVNQHLCGSHLVEALYLVCGERGF+ TP T 140 gi|1147285671|ref|XP_020024407.1| XP_020024407 insulin [Castor canadensis] 51338 Castor canadensis 110 1 60.8474 146 6.37428e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 141 gi|124588|sp|P01313.2|INS_CRILO P01313 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 10030 Cricetulus longicaudatus gi|2137094|pir||I48166 I48166 insulin precursor - golden hamster 10036 Mesocricetus auratus gi|305360|gb|AAA37089.1| AAA37089 preproinsulin [Mesocricetus auratus] 10036 Mesocricetus auratus 110 1 60.8474 146 6.44064e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 142 gi|880853612|ref|XP_012968060.1| XP_012968060 insulin [Mesocricetus auratus] 10036 Mesocricetus auratus 110 1 60.8474 146 6.44064e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 143 gi|589929074|ref|XP_006977353.1| XP_006977353 PREDICTED: insulin [Peromyscus maniculatus bairdii] 230844 Peromyscus maniculatus bairdii gi|589929076|ref|XP_006977354.1| XP_006977354 PREDICTED: insulin [Peromyscus maniculatus bairdii] 230844 Peromyscus maniculatus bairdii 110 1 60.8474 146 6.5077e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 144 gi|674061413|ref|XP_008837427.1| XP_008837427 PREDICTED: insulin isoform X2 [Nannospalax galili] 1026970 Nannospalax galili 98 1 60.4622 145 6.72084e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 145 gi|126723332|ref|NP_001075804.1| NP_001075804 insulin precursor [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus gi|1352467|sp|P01311.2|INS_RABIT P01311 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9986 Oryctolagus cuniculus gi|467971|gb|AAA19033.1| AAA19033 insulin [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 110 1 60.8474 146 6.78294e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 146 gi|859820713|ref|XP_012915491.1| XP_012915491 PREDICTED: insulin [Mustela putorius furo] 9669 Mustela putorius furo gi|859820717|ref|XP_004759728.2| XP_004759728 PREDICTED: insulin [Mustela putorius furo] 9669 Mustela putorius furo 109 1 60.8474 146 6.8238e-10 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 147 gi|82749736|gb|ABB89752.1| ABB89752 preproinsulin [Microtus kikuchii] 100899 Microtus kikuchii 110 1 60.8474 146 6.85354e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 148 gi|354491975|ref|XP_003508128.1| XP_003508128 PREDICTED: insulin [Cricetulus griseus] 10029 Cricetulus griseus gi|625267846|ref|XP_007625431.1| XP_007625431 PREDICTED: insulin [Cricetulus griseus] 10029 Cricetulus griseus gi|537202506|gb|ERE79495.1| ERE79495 insulin-like isoform 1 [Cricetulus griseus] 10029 Cricetulus griseus 110 1 60.8474 146 7.2177e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 149 gi|229682|pdb|1APH|B 1APH_B Chain B, CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 9913 Bos taurus gi|229723|pdb|1BPH|B 1BPH_B Chain B, CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 9913 Bos taurus gi|229765|pdb|1CPH|B 1CPH_B Chain B, CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 9913 Bos taurus gi|229888|pdb|1DPH|B 1DPH_B Chain B, CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 9913 Bos taurus gi|231039|pdb|4INS|B 4INS_B Chain B, THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION 9823 Sus scrofa gi|231041|pdb|4INS|D 4INS_D Chain D, THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION 9823 Sus scrofa gi|231330|pdb|9INS|B 9INS_B Chain B, MONOVALENT CATION BINDING IN CUBIC INSULIN CRYSTALS 9823 Sus scrofa gi|494930|pdb|7INS|B 7INS_B Chain B, Structure Of Porcine Insulin Cocrystallized With Clupeine Z 9823 Sus scrofa gi|494932|pdb|7INS|D 7INS_D Chain D, Structure Of Porcine Insulin Cocrystallized With Clupeine Z 9823 Sus scrofa gi|494934|pdb|7INS|F 7INS_F Chain F, Structure Of Porcine Insulin Cocrystallized With Clupeine Z 9823 Sus scrofa gi|1310727|pdb|3MTH|B 3MTH_B Chain B, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310729|pdb|3MTH|D 3MTH_D Chain D, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310731|pdb|2TCI|B 2TCI_B Chain B, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310733|pdb|2TCI|D 2TCI_D Chain D, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310805|pdb|1MPJ|B 1MPJ_B Chain B, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310807|pdb|1MPJ|D 1MPJ_D Chain D, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1942067|pdb|1WAV|B 1WAV_B Chain B, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942069|pdb|1WAV|D 1WAV_D Chain D, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942071|pdb|1WAV|F 1WAV_F Chain F, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942073|pdb|1WAV|H 1WAV_H Chain H, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942075|pdb|1WAV|J 1WAV_J Chain J, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942077|pdb|1WAV|L 1WAV_L Chain L, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|2914279|pdb|1ZNI|B 1ZNI_B Chain B, INSULIN 9823 Sus scrofa gi|2914281|pdb|1ZNI|D 1ZNI_D Chain D, INSULIN 9823 Sus scrofa gi|23200471|pdb|1M5A|B 1M5A_B Chain B, Crystal Structure Of 2-co(2+)-insulin At 1.2a Resolution 9823 Sus scrofa gi|23200473|pdb|1M5A|D 1M5A_D Chain D, Crystal Structure Of 2-co(2+)-insulin At 1.2a Resolution 9823 Sus scrofa gi|30749214|pdb|1B17|B 1B17_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 5.00 Coordinates) 9823 Sus scrofa gi|30749216|pdb|1B18|B 1B18_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 5.53 Coordinates) 9823 Sus scrofa gi|30749218|pdb|1B19|B 1B19_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 5.80 Coordinates) 9823 Sus scrofa gi|30749220|pdb|1B2A|B 1B2A_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.00 Coordinates) 9823 Sus scrofa gi|30749222|pdb|1B2B|B 1B2B_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.16 Coordinates) 9823 Sus scrofa gi|30749224|pdb|1B2C|B 1B2C_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.26 Coordinates) 9823 Sus scrofa gi|30749226|pdb|1B2D|B 1B2D_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.35 Coordinates) 9823 Sus scrofa gi|30749228|pdb|1B2E|B 1B2E_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.50 Coordinates) 9823 Sus scrofa gi|30749230|pdb|1B2F|B 1B2F_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.98 Coordinates) 9823 Sus scrofa gi|30749232|pdb|1B2G|B 1B2G_B Chain B, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 9.00 Coordinates) 9823 Sus scrofa gi|78101622|pdb|2BN1|B 2BN1_B Chain B, Insulin After A High Dose X-ray Burn 9913 Bos taurus gi|78101624|pdb|2BN3|B 2BN3_B Chain B, Insulin Before A High Dose X-Ray Burn 9913 Bos taurus gi|82407659|pdb|2A3G|B 2A3G_B Chain B, The Structure Of T6 Bovine Insulin 9913 Bos taurus gi|82407661|pdb|2A3G|D 2A3G_D Chain D, The Structure Of T6 Bovine Insulin 9913 Bos taurus gi|134104330|pdb|2G4M|B 2G4M_B Chain B, Insulin Collected At 2.0 A Wavelength 9823 Sus scrofa gi|194368652|pdb|2ZP6|B 2ZP6_B Chain B, Crystal Structure Of Bovine Insulin (Hexameric Form) 9913 Bos taurus gi|194368654|pdb|2ZP6|D 2ZP6_D Chain D, Crystal Structure Of Bovine Insulin (Hexameric Form) 9913 Bos taurus gi|225734318|pdb|3GKY|B 3GKY_B Chain B, The Structural Basis of an ER Stress-Associated Bottleneck in a Protein Folding Landscape gi|225734320|pdb|3GKY|D 3GKY_D Chain D, The Structural Basis of an ER Stress-Associated Bottleneck in a Protein Folding Landscape gi|283135364|pdb|3I3Z|B 3I3Z_B Chain B, Human Insulin 9606 Homo sapiens gi|283135366|pdb|3I40|B 3I40_B Chain B, Human Insulin 9606 Homo sapiens gi|333361519|pdb|3RTO|B 3RTO_B Chain B, Acoustically Mounted Porcine Insulin Microcrystals Yield An X-Ray Sad Structure 9823 Sus scrofa gi|333361521|pdb|3RTO|D 3RTO_D Chain D, Acoustically Mounted Porcine Insulin Microcrystals Yield An X-Ray Sad Structure 9823 Sus scrofa gi|353529983|pdb|2EFA|B 2EFA_B Chain B, Neutron crystal structure of cubic insulin at pD6.6 9823 Sus scrofa gi|353529986|pdb|2ZPP|B 2ZPP_B Chain B, Neutron crystal structure of cubic insulin at pD9 9823 Sus scrofa gi|353529990|pdb|3FHP|B 3FHP_B Chain B, A neutron crystallographic analysis of a porcine 2Zn insulin at 2.0 A resolution 9823 Sus scrofa gi|353529992|pdb|3FHP|D 3FHP_D Chain D, A neutron crystallographic analysis of a porcine 2Zn insulin at 2.0 A resolution 9823 Sus scrofa gi|358440269|pdb|4A7E|B 4A7E_B Chain B, X-Ray Crystal Structure Of Porcine Insulin Flash-Cooled At High Pressure 9823 Sus scrofa gi|365813087|pdb|3T2A|B 3T2A_B Chain B, Tmao-Grown Cubic Insulin (Porcine) 9823 Sus scrofa gi|383280400|pdb|4E7T|B 4E7T_B Chain B, The structure of T6 bovine insulin 9913 Bos taurus gi|383280402|pdb|4E7T|D 4E7T_D Chain D, The structure of T6 bovine insulin 9913 Bos taurus gi|383280404|pdb|4E7U|B 4E7U_B Chain B, The structure of T3R3 bovine insulin 9913 Bos taurus gi|383280406|pdb|4E7U|D 4E7U_D Chain D, The structure of T3R3 bovine insulin 9913 Bos taurus gi|383280408|pdb|4E7V|B 4E7V_B Chain B, The structure of R6 bovine insulin 9913 Bos taurus gi|383280410|pdb|4E7V|D 4E7V_D Chain D, The structure of R6 bovine insulin 9913 Bos taurus gi|383280412|pdb|4E7V|F 4E7V_F Chain F, The structure of R6 bovine insulin 9913 Bos taurus gi|383280414|pdb|4E7V|H 4E7V_H Chain H, The structure of R6 bovine insulin 9913 Bos taurus gi|383280416|pdb|4E7V|J 4E7V_J Chain J, The structure of R6 bovine insulin 9913 Bos taurus gi|383280418|pdb|4E7V|L 4E7V_L Chain L, The structure of R6 bovine insulin 9913 Bos taurus gi|383280420|pdb|4E7V|N 4E7V_N Chain N, The structure of R6 bovine insulin 9913 Bos taurus gi|383280422|pdb|4E7V|P 4E7V_P Chain P, The structure of R6 bovine insulin 9913 Bos taurus gi|383280424|pdb|4E7V|R 4E7V_R Chain R, The structure of R6 bovine insulin 9913 Bos taurus gi|383280426|pdb|4E7V|T 4E7V_T Chain T, The structure of R6 bovine insulin 9913 Bos taurus gi|383280428|pdb|4E7V|V 4E7V_V Chain V, The structure of R6 bovine insulin 9913 Bos taurus gi|383280430|pdb|4E7V|X 4E7V_X Chain X, The structure of R6 bovine insulin 9913 Bos taurus gi|383280432|pdb|4E7V|Z 4E7V_Z Chain Z, The structure of R6 bovine insulin 9913 Bos taurus gi|383280434|pdb|4E7V|2 4E7V_2 Chain 2, The structure of R6 bovine insulin 9913 Bos taurus gi|383280436|pdb|4E7V|4 4E7V_4 Chain 4, The structure of R6 bovine insulin 9913 Bos taurus gi|383280438|pdb|4E7V|6 4E7V_6 Chain 6, The structure of R6 bovine insulin 9913 Bos taurus gi|440690603|pdb|3W14|B 3W14_B Chain B, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 9913 Bos taurus gi|440690609|pdb|3W14|J 3W14_J Chain J, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 9913 Bos taurus gi|510102068|pdb|4IDW|B 4IDW_B Chain B, Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution And Novel Structure Refinement Strategy 9913 Bos taurus gi|510102070|pdb|4IDW|D 4IDW_D Chain D, Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution And Novel Structure Refinement Strategy 9913 Bos taurus gi|524933734|pdb|4BS3|B 4BS3_B Chain B, Bovin Insulin Structure Determined By In Situ Crystal Analysis And Sulfur-sad Phasing At Room Temperature 9913 Bos taurus gi|532138146|pdb|3INS|B 3INS_B Chain B, STRUCTURE OF INSULIN. RESULTS OF JOINT NEUTRON AND X-RAY REFINEMENT 9823 Sus scrofa gi|532138148|pdb|3INS|D 3INS_D Chain D, STRUCTURE OF INSULIN. RESULTS OF JOINT NEUTRON AND X-RAY REFINEMENT 9823 Sus scrofa gi|558704969|pdb|4I5Y|B 4I5Y_B Chain B, Insulin Protein Crystallization Via Langmuir-blodgett 9913 Bos taurus gi|558704971|pdb|4I5Z|B 4I5Z_B Chain B, Insulin Protein Crystallization Via Langmuir-blodgett 9913 Bos taurus gi|568786541|pdb|4IHN|B 4IHN_B Chain B, High Resolution Insulin By Langmuir-blodgett Modified Hanging Drop Vapour Diffusion 9913 Bos taurus gi|574451246|pdb|4M4F|B 4M4F_B Chain B, Radiation damage study of Cu T6-insulin - 0.01 MGy 9913 Bos taurus gi|574451248|pdb|4M4F|D 4M4F_D Chain D, Radiation damage study of Cu T6-insulin - 0.01 MGy 9913 Bos taurus gi|574451250|pdb|4M4H|B 4M4H_B Chain B, Radiation damage study of Cu T6-insulin - 0.06 MGy 9913 Bos taurus gi|574451252|pdb|4M4H|D 4M4H_D Chain D, Radiation damage study of Cu T6-insulin - 0.06 MGy 9913 Bos taurus gi|574451254|pdb|4M4I|B 4M4I_B Chain B, Radiation damage study of Cu T6-insulin - 0.12 MGy 9913 Bos taurus gi|574451256|pdb|4M4I|D 4M4I_D Chain D, Radiation damage study of Cu T6-insulin - 0.12 MGy 9913 Bos taurus gi|574451258|pdb|4M4J|B 4M4J_B Chain B, Radiation damage study of Cu T6-insulin - 0.30 MGy 9913 Bos taurus gi|574451260|pdb|4M4J|D 4M4J_D Chain D, Radiation damage study of Cu T6-insulin - 0.30 MGy 9913 Bos taurus gi|574451262|pdb|4M4L|B 4M4L_B Chain B, The structure of Cu T6 bovine insulin 9913 Bos taurus gi|574451264|pdb|4M4L|D 4M4L_D Chain D, The structure of Cu T6 bovine insulin 9913 Bos taurus gi|574451266|pdb|4M4M|B 4M4M_B Chain B, The structure of Ni T6 bovine insulin 9913 Bos taurus gi|574451268|pdb|4M4M|D 4M4M_D Chain D, The structure of Ni T6 bovine insulin 9913 Bos taurus gi|973744256|pdb|5D52|B 5D52_B Chain B, In Meso In Situ Serial X-ray Crystallography Structure Of Insulin At Room Temperature 9823 Sus scrofa gi|973744258|pdb|5D53|B 5D53_B Chain B, In Meso In Situ Serial X-ray Crystallography Structure Of Insulin At 100 K 9823 Sus scrofa gi|973744260|pdb|5D54|B 5D54_B Chain B, In Meso X-ray Crystallography Structure Of Insulin At 100 K 9823 Sus scrofa gi|973744280|pdb|5D5E|B 5D5E_B Chain B, In Meso In Situ Serial X-ray Crystallography Structure Of Insulin By Sulfur-sad At 100 K 9823 Sus scrofa gi|1036305198|pdb|5FB6|B 5FB6_B Chain B, Room-temperature Macromolecular Crystallography Using A Micro- Patterned Silicon Chip With Minimal Background Scattering 9823 Sus scrofa gi|1049306340|pdb|5LIS|B 5LIS_B Chain B, Insulin Solved By Native Sad From A Dataset Collected In One Second 9823 Sus scrofa gi|1134776320|pdb|5MIZ|B 5MIZ_B Chain B, MD ensemble of bovine insulin 9913 Bos taurus gi|1216873255|pdb|5KQV|B 5KQV_B Chain B, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 (revised Structure) 9913 Bos taurus gi|1216873261|pdb|5KQV|J 5KQV_J Chain J, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 (revised Structure) 9913 Bos taurus gi|1364950892|pdb|6CE7|O 6CE7_O Chain O, Insulin Receptor ectodomain in complex with one insulin molecule gi|1364950900|pdb|6CE9|L 6CE9_L Chain L, Insulin Receptor ectodomain in complex with two insulin molecules gi|1364950902|pdb|6CE9|O 6CE9_O Chain O, Insulin Receptor ectodomain in complex with two insulin molecules gi|1364950910|pdb|6CEB|L 6CEB_L Chain L, Insulin Receptor ectodomain in complex with two insulin molecules - C1 symmetry gi|1364950912|pdb|6CEB|O 6CEB_O Chain O, Insulin Receptor ectodomain in complex with two insulin molecules - C1 symmetry gi|299300|gb|AAB25817.1| AAB25817 insulin B-chain, partial [Equus przewalskii] 9798 Equus przewalskii 30 1 59.3066 142 7.29343e-10 27 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 150 gnl|mdb|bmrb884:1 bmrb884:1 insulin B chain 30 1 59.3066 142 7.29343e-10 27 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 151 gnl|mdb|bmrb883:1 bmrb883:1 insulin B chain 30 1 59.3066 142 7.29343e-10 27 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 152 gnl|mdb|bmrb1444:1 bmrb1444:1 insulin B chain 30 1 59.3066 142 7.29343e-10 27 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 153 gi|1229749565|pdb|5MHD|B 5MHD_B Chain B, Biosynthetic engineered A22S-B3K-B31R human insulin monomer structure in water/acetonitrile solutions. 9606 Homo sapiens 31 1 59.3066 142 7.43223e-10 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPKT FV QHLCGSHLVEALYLVCGERGFF TP T 154 gi|1131252127|ref|XP_019810290.1| XP_019810290 PREDICTED: insulin isoform X1 [Bos indicus] 9915 Bos indicus 149 1 61.2326 147 7.54013e-10 27 27 22 49 69 96 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 155 gi|532015731|ref|XP_005351629.1| XP_005351629 PREDICTED: insulin isoform X1 [Microtus ochrogaster] 79684 Microtus ochrogaster 110 1 60.8474 146 7.60115e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 156 gi|301769513|ref|XP_002920166.1| XP_002920166 PREDICTED: insulin [Ailuropoda melanoleuca] 9646 Ailuropoda melanoleuca 109 1 60.8474 146 7.64749e-10 27 27 21 49 24 52 29 0 NFVNQHLCGSHLVEALYLVCGERGFFXTP TFVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 157 gi|532691822|ref|NP_001269184.1| NP_001269184 insulin precursor [Ictidomys tridecemlineatus] 43179 Ictidomys tridecemlineatus gi|29427536|sp|Q91XI3.1|INS_SPETR Q91XI3 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 43179 Ictidomys tridecemlineatus gi|14906249|gb|AAK72558.1| AAK72558 insulin [Ictidomys tridecemlineatus] 43179 Ictidomys tridecemlineatus 110 1 60.8474 146 7.76016e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 158 gi|6573507|pdb|1B9E|B 1B9E_B Chain B, Human Insulin Mutant Serb9glu 9606 Homo sapiens gi|6573509|pdb|1B9E|D 1B9E_D Chain D, Human Insulin Mutant Serb9glu 9606 Homo sapiens 30 1 59.3066 142 7.94246e-10 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGEHLVEALYLVCGERGFFYTPKT FVNQHLCG HLVEALYLVCGERGFF TP T 159 gi|831240254|ref|XP_012665959.1| XP_012665959 insulin isoform X2 [Otolemur garnettii] 30611 Otolemur garnettii 98 1 60.4622 145 8.36611e-10 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 160 gi|69316|pir||INHY INHY insulin - hamster 36483 Cricetinae gen. sp. 51 1 59.3066 142 8.3675e-10 27 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 161 gi|829949369|ref|XP_012599453.1| XP_012599453 insulin [Microcebus murinus] 30608 Microcebus murinus 110 1 60.4622 145 8.43004e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 162 gi|2392616|pdb|1XDA|B 1XDA_B Chain B, Structure Of Insulin 9606 Homo sapiens gi|2392618|pdb|1XDA|D 1XDA_D Chain D, Structure Of Insulin 9606 Homo sapiens gi|2392620|pdb|1XDA|F 1XDA_F Chain F, Structure Of Insulin 9606 Homo sapiens gi|2392622|pdb|1XDA|H 1XDA_H Chain H, Structure Of Insulin 9606 Homo sapiens gi|62738083|pdb|1UZ9|B 1UZ9_B Chain B, Crystallographic And Solution Studies Of N-Lithocholyl Insulin: A New Generation Of Prolonged-Acting Insulins. 9606 Homo sapiens gi|93278994|pdb|2C8Q|B 2C8Q_B Chain B, Insuline(1sec) And Uv Laser Excited Fluorescence 9606 Homo sapiens gi|93278996|pdb|2C8R|B 2C8R_B Chain B, Insuline(60sec) And Uv Laser Excited Fluorescence 9606 Homo sapiens gi|224036337|pdb|3E7Y|B 3E7Y_B Chain B, Structure Of Human Insulin 9606 Homo sapiens gi|224036339|pdb|3E7Y|D 3E7Y_D Chain D, Structure Of Human Insulin 9606 Homo sapiens gi|224036341|pdb|3E7Z|B 3E7Z_B Chain B, Structure Of Human Insulin 9606 Homo sapiens gi|224036343|pdb|3E7Z|D 3E7Z_D Chain D, Structure Of Human Insulin 9606 Homo sapiens gi|281500601|pdb|2W44|B 2W44_B Chain B, Structure DeltaA1-A4 insulin 9606 Homo sapiens gi|281500603|pdb|2W44|D 2W44_D Chain D, Structure DeltaA1-A4 insulin 9606 Homo sapiens gi|281500605|pdb|2W44|F 2W44_F Chain F, Structure DeltaA1-A4 insulin 9606 Homo sapiens gi|440690682|pdb|4AJX|B 4AJX_B Chain B, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690684|pdb|4AJX|D 4AJX_D Chain D, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690686|pdb|4AJX|F 4AJX_F Chain F, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690688|pdb|4AJX|H 4AJX_H Chain H, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690690|pdb|4AJX|J 4AJX_J Chain J, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690692|pdb|4AJX|L 4AJX_L Chain L, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690694|pdb|4AJZ|B 4AJZ_B Chain B, Ligand controlled assembly of hexamers, dihexamers, and linear multihexamer structures by an engineered acylated insulin 9606 Homo sapiens gi|440690696|pdb|4AJZ|D 4AJZ_D Chain D, Ligand controlled assembly of hexamers, dihexamers, and linear multihexamer structures by an engineered acylated insulin 9606 Homo sapiens gi|440690698|pdb|4AK0|B 4AK0_B Chain B, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690700|pdb|4AKJ|B 4AKJ_B Chain B, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690702|pdb|4AKJ|D 4AKJ_D Chain D, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|584579721|pdb|4IYD|B 4IYD_B Chain B, Insulin Glargine Crystal Structure 1 9606 Homo sapiens gi|584579723|pdb|4IYF|B 4IYF_B Chain B, Insulin Glargine Crystal Structure 2 9606 Homo sapiens gi|1270516719|pdb|5VIZ|B 5VIZ_B Chain B, X-ray Structure Of Insulin Glargine 9606 Homo sapiens 29 1 58.9214 141 8.49549e-10 27 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 163 gi|674061411|ref|XP_008837426.1| XP_008837426 PREDICTED: insulin isoform X1 [Nannospalax galili] 1026970 Nannospalax galili 110 1 60.4622 145 8.60633e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 164 gi|852762798|ref|XP_012876479.1| XP_012876479 PREDICTED: insulin [Dipodomys ordii] 10020 Dipodomys ordii 102 1 60.4622 145 8.73143e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 165 gi|1121898651|ref|XP_019522928.1| XP_019522928 PREDICTED: insulin [Hipposideros armiger] 186990 Hipposideros armiger 110 1 60.4622 145 8.87767e-10 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 166 gi|184185545|gb|ACC68945.1| ACC68945 proinsulin precursor (predicted) [Rhinolophus ferrumequinum] 59479 Rhinolophus ferrumequinum 110 1 60.4622 145 9.06329e-10 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 167 gi|1124018742|ref|XP_019569256.1| XP_019569256 PREDICTED: insulin [Rhinolophus sinicus] 89399 Rhinolophus sinicus 110 1 60.4622 145 9.06329e-10 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 168 gi|395851760|ref|XP_003798420.1| XP_003798420 insulin isoform X1 [Otolemur garnettii] 30611 Otolemur garnettii gi|197215716|gb|ACH53103.1| ACH53103 insulin (predicted) [Otolemur garnettii] 30611 Otolemur garnettii 110 1 60.4622 145 9.15755e-10 28 29 14 49 17 52 36 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP WGPEPAPAFVNQHLCGSHLVEALYLVCGERGFFYTP + E FVNQHLCGSHLVEALYLVCGERGFF TP 169 gi|1111233617|ref|XP_019292555.1| XP_019292555 PREDICTED: insulin [Panthera pardus] 9691 Panthera pardus 110 1 60.4622 145 9.349e-10 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 170 gi|57163807|ref|NP_001009272.1| NP_001009272 insulin precursor [Felis catus] 9685 Felis catus gi|1126455429|ref|XP_019666739.1| XP_019666739 insulin isoform X1 [Felis catus] 9685 Felis catus gi|90110828|sp|P06306.2|INS_FELCA P06306 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9685 Felis catus gi|18376637|dbj|BAB84110.1| BAB84110 preproinsulin [Felis catus] 9685 Felis catus 110 1 60.4622 145 9.349e-10 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 171 gi|3885494|gb|AAC77920.1| AAC77920 preproinsulin, partial [Sus scrofa] 9823 Sus scrofa 127 1 60.8474 146 9.59756e-10 27 27 22 49 44 71 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 172 gi|1244105274|ref|XP_022363428.1| XP_022363428 insulin [Enhydra lutris kenyoni] 391180 Enhydra lutris kenyoni 109 1 60.4622 145 9.604e-10 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 173 gi|159162412|pdb|1HLS|B 1HLS_B Chain B, NMR STRUCTURE OF THE HUMAN INSULIN-HIS(B16) 9606 Homo sapiens 30 1 58.9214 141 9.6215e-10 27 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALHLVCGERGFFYTPKT FVNQHLCGSHLVEAL+LVCGERGFF TP T 174 gi|62526545|gb|AAX84658.1| AAX84658 preproinsulin, partial [Felis catus] 9685 Felis catus 86 1 60.077 144 9.65558e-10 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 175 gi|217418318|gb|ACK44319.1| ACK44319 insulin (predicted) [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 110 1 60.4622 145 9.84527e-10 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 176 gi|442540383|gb|AGC54790.1| AGC54790 insulin precursor, partial [synthetic construct] 32630 synthetic construct 63 1 59.3066 142 1.02478e-09 27 27 21 49 10 38 29 0 NFVNQHLCGSHLVEALYLVCGERGFFXTP KFVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 177 gi|5542373|pdb|1QIY|B 1QIY_B Chain B, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542377|pdb|1QIY|F 1QIY_F Chain F, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542379|pdb|1QIY|H 1QIY_H Chain H, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542381|pdb|1QIY|J 1QIY_J Chain J, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542383|pdb|1QIY|L 1QIY_L Chain L, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542385|pdb|1QIZ|B 1QIZ_B Chain B, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542389|pdb|1QIZ|F 1QIZ_F Chain F, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542391|pdb|1QIZ|H 1QIZ_H Chain H, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542393|pdb|1QIZ|J 1QIZ_J Chain J, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542395|pdb|1QIZ|L 1QIZ_L Chain L, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542397|pdb|1QJ0|B 1QJ0_B Chain B, Human Insulin Hexamers With Chain B His Mutated To Tyr 9606 Homo sapiens gi|5542399|pdb|1QJ0|D 1QJ0_D Chain D, Human Insulin Hexamers With Chain B His Mutated To Tyr 9606 Homo sapiens 30 1 58.9214 141 1.02565e-09 27 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQYLCGSHLVEALYLVCGERGFFYTPKT FVNQ+LCGSHLVEALYLVCGERGFF TP T 178 gi|955539830|ref|XP_014651319.1| XP_014651319 PREDICTED: insulin [Ceratotherium simum simum] 73337 Ceratotherium simum simum 110 1 60.4622 145 1.04756e-09 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 179 gi|731187698|pdb|2MVD|B 2MVD_B Chain B, Solution structure of [GlnB22]-insulin mutant at pH 1.9 30 1 58.9214 141 1.0703e-09 27 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGEQGFFYTPKT FVNQHLCGSHLVEALYLVCGE+GFF TP T 180 gi|1040144916|ref|XP_017196107.1| XP_017196107 PREDICTED: insulin isoform X1 [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 138 1 60.8474 146 1.07828e-09 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 181 gi|585198264|ref|XP_006750158.1| XP_006750158 PREDICTED: insulin [Leptonychotes weddellii] 9713 Leptonychotes weddellii 110 1 60.4622 145 1.11461e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 182 gi|664769953|ref|XP_008542536.1| XP_008542536 PREDICTED: insulin [Equus przewalskii] 9798 Equus przewalskii gi|1333567577|ref|XP_023510474.1| XP_023510474 insulin [Equus caballus] 9796 Equus caballus 110 1 60.4622 145 1.11461e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 183 gi|194272230|ref|NP_001123565.1| NP_001123565 insulin precursor [Canis lupus familiaris] 9615 Canis lupus familiaris gi|124575|sp|P01321.1|INS_CANFA P01321 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9615 Canis lupus familiaris gi|995|emb|CAA23475.1| CAA23475 preproinsulin [Canis sp.] 9616 Canis sp. 110 1 60.077 144 1.12619e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 184 gi|1348557514|ref|XP_023973345.1| XP_023973345 insulin [Physeter catodon] 9755 Physeter catodon 110 1 60.077 144 1.19826e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 185 gi|157838278|pdb|1BEN|B 1BEN_B Chain B, Insulin Complexed With 4-Hydroxybenzamide 32630 synthetic construct gi|157838280|pdb|1BEN|D 1BEN_D Chain D, Insulin Complexed With 4-Hydroxybenzamide 32630 synthetic construct 30 1 58.5362 140 1.20334e-09 27 27 23 51 2 30 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYTPKT VNQHLCGSHLVEALYLVCGERGFF TP T 186 gi|7438602|pir||A59151 A59151 insulin precursor - jack bean (fragments) 3823 Canavalia ensiformis 51 1 58.9214 141 1.21322e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 187 gi|984133696|ref|XP_015358821.1| XP_015358821 PREDICTED: insulin isoform X1 [Marmota marmota marmota] 9994 Marmota marmota marmota 135 1 60.4622 145 1.21904e-09 27 28 22 51 62 91 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 188 gi|32171944|sp|P01314.1|INS_BALBO P01314 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9768 Balaenoptera borealis 51 1 58.9214 141 1.22616e-09 27 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 189 gi|32171956|sp|P01324.1|INS_ACOCA P01324 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 10068 Acomys cahirinus 51 1 58.9214 141 1.22616e-09 26 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVBQHLCGSHLVEALYLVCGERGFFYTPKS FV+QHLCGSHLVEALYLVCGERGFF TP + 190 gi|984133698|ref|XP_015358822.1| XP_015358822 PREDICTED: insulin isoform X2 [Marmota marmota marmota] 9994 Marmota marmota marmota 147 1 60.4622 145 1.22662e-09 27 28 22 51 62 91 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 191 gi|532015729|ref|XP_005351628.1| XP_005351628 PREDICTED: insulin isoform X2 [Microtus ochrogaster] 79684 Microtus ochrogaster 135 1 60.4622 145 1.24403e-09 27 28 22 51 50 79 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 192 gi|958805614|ref|XP_014685720.1| XP_014685720 PREDICTED: insulin [Equus asinus] 9793 Equus asinus 110 1 60.077 144 1.24884e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 193 gi|54037403|sp|P67973.1|INS_BALPH P67973 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9770 Balaenoptera physalus gi|54037406|sp|P67974.1|INS_PHYCD P67974 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9755 Physeter catodon 51 1 58.9214 141 1.27933e-09 27 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 194 gi|987950427|ref|XP_015420950.1| XP_015420950 PREDICTED: insulin [Myotis davidii] 225400 Myotis davidii 106 1 60.077 144 1.28016e-09 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 195 gi|634871686|ref|XP_007947471.1| XP_007947471 PREDICTED: insulin-like [Orycteropus afer afer] 1230840 Orycteropus afer afer 104 1 60.077 144 1.34996e-09 27 28 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVSQHLCGSHLVEALYLVCGERGFFYTPKT FV+QHLCGSHLVEALYLVCGERGFF TP T 196 gi|172073148|ref|NP_001103242.1| NP_001103242 insulin precursor [Sus scrofa] 9823 Sus scrofa gi|12643972|sp|P01315.2|INS_PIG P01315 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9823 Sus scrofa gi|21956487|gb|AAL69550.1| AAL69550 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242506|gb|AAQ00952.1| AAQ00952 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242509|gb|AAQ00954.1| AAQ00954 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242513|gb|AAQ00957.1| AAQ00957 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242517|gb|AAQ00960.1| AAQ00960 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242521|gb|AAQ00963.1| AAQ00963 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242525|gb|AAQ00966.1| AAQ00966 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242529|gb|AAQ00969.1| AAQ00969 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242533|gb|AAQ00972.1| AAQ00972 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242537|gb|AAQ00975.1| AAQ00975 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242541|gb|AAQ00978.1| AAQ00978 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242545|gb|AAQ00981.1| AAQ00981 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242548|gb|AAQ00983.1| AAQ00983 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242551|gb|AAQ00985.1| AAQ00985 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242554|gb|AAQ00987.1| AAQ00987 preproinsulin [Sus scrofa] 9823 Sus scrofa gi|33242558|gb|AAQ00990.1| AAQ00990 preproinsulin [Sus scrofa] 9823 Sus scrofa 108 1 60.077 144 1.35975e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 197 gi|1378858233|ref|XP_024605021.1| XP_024605021 insulin [Neophocaena asiaeorientalis asiaeorientalis] 1706337 Neophocaena asiaeorientalis asiaeorientalis gi|1378858236|ref|XP_024605022.1| XP_024605022 insulin [Neophocaena asiaeorientalis asiaeorientalis] 1706337 Neophocaena asiaeorientalis asiaeorientalis 110 1 60.077 144 1.37056e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 198 gi|1048405903|ref|XP_017524755.1| XP_017524755 PREDICTED: insulin [Manis javanica] 9974 Manis javanica 104 1 60.077 144 1.37826e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 199 gi|1246201222|ref|XP_022446762.1| XP_022446762 insulin isoform X1 [Delphinapterus leucas] 9749 Delphinapterus leucas gi|1246201224|ref|XP_022446763.1| XP_022446763 insulin isoform X1 [Delphinapterus leucas] 9749 Delphinapterus leucas 110 1 60.077 144 1.3848e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 200 gi|555983334|ref|XP_005903567.1| XP_005903567 PREDICTED: insulin [Bos mutus] 72004 Bos mutus 114 1 60.077 144 1.40432e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 201 gi|1212181548|ref|XP_021540854.1| XP_021540854 insulin [Neomonachus schauinslandi] 29088 Monachus schauinslandi 110 1 60.077 144 1.42839e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 202 gi|2497407|sp|Q62587.1|INS_PSAOB Q62587 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 48139 Psammomys obesus gi|1370283|emb|CAA66897.1| CAA66897 preproinsulin [Psammomys obesus] 48139 Psammomys obesus 110 1 60.077 144 1.42839e-09 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 203 gi|472368670|ref|XP_004403859.1| XP_004403859 PREDICTED: insulin [Odobenus rosmarus divergens] 9708 Odobenus rosmarus divergens 110 1 60.077 144 1.42839e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 204 gi|124564|sp|P01317.2|INS_BOVIN P01317 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9913 Bos taurus gi|163579|gb|AAA30722.1| AAA30722 insulin precursor [Bos taurus] 9913 Bos taurus 105 1 59.6918 143 1.45826e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 205 gi|494923|pdb|6INS|E 6INS_E Chain E, X-Ray Analysis Of The Single Chain B29-A1 Peptide-Linked Insulin Molecule. A Completely Inactive Analogue 9823 Sus scrofa gi|494924|pdb|6INS|F 6INS_F Chain F, X-Ray Analysis Of The Single Chain B29-A1 Peptide-Linked Insulin Molecule. A Completely Inactive Analogue 9823 Sus scrofa 50 1 58.9214 141 1.4594e-09 27 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 206 gi|1246201226|ref|XP_022446765.1| XP_022446765 insulin isoform X2 [Delphinapterus leucas] 9749 Delphinapterus leucas 98 1 59.6918 143 1.49917e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 207 gi|188595956|pdb|3BXQ|B 3BXQ_B Chain B, The Structure Of A Mutant Insulin Uncouples Receptor Binding From Protein Allostery. An Electrostatic Block To The Tr Transition 32630 synthetic construct gi|188595958|pdb|3BXQ|D 3BXQ_D Chain D, The Structure Of A Mutant Insulin Uncouples Receptor Binding From Protein Allostery. An Electrostatic Block To The Tr Transition 32630 synthetic construct 30 1 58.5362 140 1.50489e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQRLCGSHLVEALYLVCGERGFFYTPKT FVNQ LCGSHLVEALYLVCGERGFF TP T 208 gi|429544232|pdb|3V1G|B 3V1G_B Chain B, Forestalling Insulin Fibrillation By Insertion Of A Chiral Clamp Mechanism-based Application Of Protein Engineering To Global Health 9606 Homo sapiens gi|429544234|pdb|3V1G|D 3V1G_D Chain D, Forestalling Insulin Fibrillation By Insertion Of A Chiral Clamp Mechanism-based Application Of Protein Engineering To Global Health 9606 Homo sapiens 30 1 58.5362 140 1.50489e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGXRGFFYTPKT FVNQHLCGSHLVEALYLVCG RGFF TP T 209 gi|32171950|sp|P01319.1|INS_CAPHI P01319 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9925 Capra hircus 51 1 58.9214 141 1.53219e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 210 gi|297591825|ref|NP_776351.2| NP_776351 insulin preproprotein [Bos taurus] 9913 Bos taurus gi|297591827|ref|NP_001172055.1| NP_001172055 insulin preproprotein [Bos taurus] 9913 Bos taurus gi|1131252131|ref|XP_019810291.1| XP_019810291 PREDICTED: insulin isoform X2 [Bos indicus] 9915 Bos indicus gi|148753357|gb|AAI42035.1| AAI42035 INS protein [Bos taurus] 9913 Bos taurus gi|187762637|gb|ACD35246.1| ACD35246 insulin [Bos taurus] 9913 Bos taurus gi|296471408|tpg|DAA13523.1| DAA13523 TPA: proinsulin precursor [Bos taurus] 9913 Bos taurus 105 1 59.6918 143 1.53581e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 211 gi|594054541|ref|XP_006051533.1| XP_006051533 PREDICTED: insulin isoform X1 [Bubalus bubalis] 89462 Bubalus bubalis gi|594054543|ref|XP_006051534.1| XP_006051534 PREDICTED: insulin isoform X2 [Bubalus bubalis] 89462 Bubalus bubalis 105 1 59.6918 143 1.53581e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 212 gi|1187570233|ref|XP_020738946.1| XP_020738946 insulin isoform X2 [Odocoileus virginianus texanus] 9880 Odocoileus virginianus texanus 105 1 59.6918 143 1.55181e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 213 gi|641735825|ref|XP_008158493.1| XP_008158493 PREDICTED: insulin [Eptesicus fuscus] 29078 Eptesicus fuscus 106 1 59.6918 143 1.55861e-09 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 214 gi|1211370651|ref|XP_021490460.1| XP_021490460 insulin isoform X2 [Meriones unguiculatus] 10047 Meriones unguiculatus gi|1211370655|ref|XP_021490469.1| XP_021490469 insulin isoform X2 [Meriones unguiculatus] 10047 Meriones unguiculatus gi|82749734|gb|ABB89751.1| ABB89751 preproinsulin [Meriones unguiculatus] 10047 Meriones unguiculatus 110 1 59.6918 143 1.58382e-09 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 215 gi|432099190|gb|ELK28555.1| ELK28555 Insulin [Myotis davidii] 225400 Myotis davidii 168 1 60.4622 145 1.58829e-09 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 216 gi|617656846|ref|XP_007535926.1| XP_007535926 PREDICTED: insulin [Erinaceus europaeus] 9365 Erinaceus europaeus 108 1 59.6918 143 1.63801e-09 27 27 22 51 24 53 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 217 gi|89331178|dbj|BAE80772.1| BAE80772 proinsulin, partial [Bubalus bubalis] 89462 Bubalus bubalis gi|397914147|gb|AFO70114.1| AFO70114 proinsulin, partial [Bos taurus] 9913 Bos taurus 81 1 59.3066 142 1.66053e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 218 gi|823670706|gb|AKI70564.1| AKI70564 INS, partial [synthetic construct] 32630 synthetic construct 110 1 59.6918 143 1.66775e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGLFYTPKT FVNQHLCGSHLVEALYLVCGERG F TP T 219 gi|124616|sp|P01310.1|INS_HORSE P01310 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9796 Equus caballus 86 1 59.3066 142 1.75458e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 220 gi|1207840020|gb|OWK17504.1| OWK17504 INS [Cervus elaphus hippelaphus] 46360 Cervus elaphus hippelaphus 105 1 59.6918 143 1.75724e-09 27 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 221 gi|985483920|pdb|5BPO|B 5BPO_B Chain B, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B29 9606 Homo sapiens gi|985483922|pdb|5BPO|D 5BPO_D Chain D, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B29 9606 Homo sapiens 30 1 58.151 139 1.76547e-09 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYXPXT FVNQHLCGSHLVEALYLVCGERGFF PXT 222 gi|1062949146|ref|XP_017898972.1| XP_017898972 PREDICTED: insulin [Capra hircus] 9925 Capra hircus gi|1062949148|ref|XP_017898973.1| XP_017898973 PREDICTED: insulin [Capra hircus] 9925 Capra hircus gi|1062949151|ref|XP_017898974.1| XP_017898974 PREDICTED: insulin [Capra hircus] 9925 Capra hircus 105 1 59.6918 143 1.86991e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 223 gi|306991613|pdb|3JSD|B 3JSD_B Chain B, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|306991615|pdb|3JSD|D 3JSD_D Chain D, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|358009477|pdb|3P2X|B 3P2X_B Chain B, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiaral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009479|pdb|3P2X|D 3P2X_D Chain D, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiaral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|641389696|pdb|4CXL|B 4CXL_B Chain B, Human Insulin Analogue (d-prob8)-insulin 9606 Homo sapiens gi|641389698|pdb|4CXN|B 4CXN_B Chain B, Crystal Structure Of Human Insulin Analogue (nme-alab8)- Insulin Crystal Form I 9606 Homo sapiens gi|641389701|pdb|4CY7|B 4CY7_B Chain B, Crystal Structure Of Human Insulin Analogue (nme-alab8)- Insulin Crystal Form Ii 9606 Homo sapiens gi|641389702|pdb|4CY7|D 4CY7_D Chain D, Crystal Structure Of Human Insulin Analogue (nme-alab8)- Insulin Crystal Form Ii 9606 Homo sapiens 30 1 58.151 139 1.90204e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCXSHLVEALYLVCGERGFFYTPKT FVNQHLC SHLVEALYLVCGERGFF TP T 224 gi|466049860|ref|XP_004278117.1| XP_004278117 PREDICTED: insulin [Orcinus orca] 9733 Orcinus orca gi|470618679|ref|XP_004317908.1| XP_004317908 PREDICTED: insulin [Tursiops truncatus] 9739 Tursiops truncatus 110 1 59.6918 143 1.92707e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 225 gi|344252373|gb|EGW08477.1| EGW08477 Insulin [Cricetulus griseus] 10029 Cricetulus griseus 248 1 60.8474 146 1.96283e-09 27 28 22 51 163 192 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKS FVNQHLCGSHLVEALYLVCGERGFF TP + 226 gi|459358290|pdb|2M2O|B 2M2O_B Chain B, Structure of [D-HisB24] insulin analogue at pH 1.9 gi|459358292|pdb|2M2P|B 2M2P_B Chain B, Structure of [D-HisB24] insulin analogue at pH 8.0 30 1 58.151 139 1.96376e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGXFYTPKT FVNQHLCGSHLVEALYLVCGERG F TP T 227 gi|344189905|pdb|3ZQR|B 3ZQR_B Chain B, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189907|pdb|3ZQR|D 3ZQR_D Chain D, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189909|pdb|3ZQR|F 3ZQR_F Chain F, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189911|pdb|3ZQR|H 3ZQR_H Chain H, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189913|pdb|3ZQR|J 3ZQR_J Chain J, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189915|pdb|3ZQR|L 3ZQR_L Chain L, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens 30 1 58.151 139 1.96376e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFXYTPKT FVNQHLCGSHLVEALYLVCGERGF TP T 228 gi|803329605|ref|XP_012022926.1| XP_012022926 PREDICTED: insulin [Ovis aries musimon] 9938 Ovis aries musimon gi|1708500|sp|P01318.2|INS_SHEEP P01318 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9940 Ovis aries gi|405982|gb|AAB60625.1| AAB60625 insulin [Ovis aries] 9940 Ovis aries 105 1 59.3066 142 2.09549e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFF TP 229 gi|459358286|pdb|2M2M|B 2M2M_B Chain B, Structure of [L-HisB24] insulin analogue at pH 1.9 gi|459358288|pdb|2M2N|B 2M2N_B Chain B, Structure of [L-HisB24] insulin analogue at pH 8.0 gi|459358428|pdb|3ZI3|B 3ZI3_B Chain B, Crystal Structure Of The B24his-insulin - Human Analogue 9606 Homo sapiens 30 1 58.151 139 2.13829e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGHFYTPKT FVNQHLCGSHLVEALYLVCGERG F TP T 230 gi|1211370647|ref|XP_021490452.1| XP_021490452 insulin isoform X1 [Meriones unguiculatus] 10047 Meriones unguiculatus 134 1 59.6918 143 2.15129e-09 27 27 22 49 49 76 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTP FVNQHLCGSHLVEALYLVCGERGFF TP 231 gi|3402132|pdb|1ZEG|B 1ZEG_B Chain B, Structure Of B28 Asp Insulin In Complex With Phenol 9606 Homo sapiens gi|3402134|pdb|1ZEG|D 1ZEG_D Chain D, Structure Of B28 Asp Insulin In Complex With Phenol 9606 Homo sapiens gi|4139763|pdb|1ZEH|B 1ZEH_B Chain B, Structure Of Insulin 9606 Homo sapiens gi|4139765|pdb|1ZEH|D 1ZEH_D Chain D, Structure Of Insulin 9606 Homo sapiens gi|512125489|pdb|4GBC|B 4GBC_B Chain B, Crystal structure of aspart insulin at pH 6.5 9606 Homo sapiens gi|512125491|pdb|4GBC|D 4GBC_D Chain D, Crystal structure of aspart insulin at pH 6.5 9606 Homo sapiens gi|512125495|pdb|4GBI|B 4GBI_B Chain B, Crystal structure of aspart insulin at pH 6.5 9606 Homo sapiens gi|512125497|pdb|4GBI|D 4GBI_D Chain D, Crystal structure of aspart insulin at pH 6.5 9606 Homo sapiens gi|512125499|pdb|4GBK|B 4GBK_B Chain B, Crystal structure of aspart insulin at pH 8.5 9606 Homo sapiens gi|512125501|pdb|4GBK|D 4GBK_D Chain D, Crystal structure of aspart insulin at pH 8.5 9606 Homo sapiens gi|512125503|pdb|4GBL|B 4GBL_B Chain B, Crystal structure of aspart insulin at pH 8.5 9606 Homo sapiens gi|512125505|pdb|4GBL|D 4GBL_D Chain D, Crystal structure of aspart insulin at pH 8.5 9606 Homo sapiens gi|512125507|pdb|4GBN|B 4GBN_B Chain B, Crystal Structure Of Aspart Insulin At Ph 6.5 9606 Homo sapiens gi|512125509|pdb|4GBN|D 4GBN_D Chain D, Crystal Structure Of Aspart Insulin At Ph 6.5 9606 Homo sapiens 30 1 58.151 139 2.25515e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTDKT FVNQHLCGSHLVEALYLVCGERGFF T T 232 gi|159162401|pdb|1HIQ|B 1HIQ_B Chain B, PARADOXICAL STRUCTURE AND FUNCTION IN A MUTANT HUMAN INSULIN ASSOCIATED WITH DIABETES MELLITUS 9606 Homo sapiens 30 1 57.7658 138 2.42955e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGSFYTPKT FVNQHLCGSHLVEALYLVCGERG F TP T 233 gnl|mdb|bmrb1021:1 bmrb1021:1 insulin B chain 30 1 57.7658 138 2.73121e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFDYTPKT FVNQHLCGSHLVEALYLVCGERGF TP T 234 gi|699027574|pdb|4P65|B 4P65_B Chain B, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027576|pdb|4P65|D 4P65_D Chain D, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027578|pdb|4P65|F 4P65_F Chain F, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027580|pdb|4P65|H 4P65_H Chain H, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027582|pdb|4P65|J 4P65_J Chain J, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027584|pdb|4P65|L 4P65_L Chain L, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|985483912|pdb|5BOQ|B 5BOQ_B Chain B, Human Insulin With Intra-chain Chemical Crosslink Between Modified B24 And B29 9606 Homo sapiens gi|985483914|pdb|5BOQ|D 5BOQ_D Chain D, Human Insulin With Intra-chain Chemical Crosslink Between Modified B24 And B29 9606 Homo sapiens gi|985483916|pdb|5BOQ|F 5BOQ_F Chain F, Human Insulin With Intra-chain Chemical Crosslink Between Modified B24 And B29 9606 Homo sapiens gi|985483918|pdb|5BOQ|H 5BOQ_H Chain H, Human Insulin With Intra-chain Chemical Crosslink Between Modified B24 And B29 9606 Homo sapiens 30 1 57.7658 138 2.91124e-09 28 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGXFYTPXT FVNQHLCGSHLVEALYLVCGERG F TPXT 235 gnl|mdb|bmrb1586:1 bmrb1586:1 insulin B chain 30 1 57.7658 138 3.27262e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHXVEALYLVCGERGFFYTPKT FVNQHLCG H VEALYLVCGERGFF TP T 236 gnl|mdb|bmrb1009:1 bmrb1009:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 237 gnl|mdb|bmrb1011:1 bmrb1011:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 238 gnl|mdb|bmrb1001:1 bmrb1001:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 239 gnl|mdb|bmrb999:1 bmrb999:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 240 gnl|mdb|bmrb1013:1 bmrb1013:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 241 gnl|mdb|bmrb997:1 bmrb997:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 242 gnl|mdb|bmrb1007:1 bmrb1007:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 243 gnl|mdb|bmrb1003:1 bmrb1003:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 244 gnl|mdb|bmrb995:1 bmrb995:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 245 gnl|mdb|bmrb1005:1 bmrb1005:1 insulin B chain 30 1 57.3806 137 3.45138e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGDHLVEALYLVCGERGFFYEPKT FVNQHLCG HLVEALYLVCGERGFF P T 246 gi|1195495223|ref|XP_021060484.1| XP_021060484 insulin-2 [Mus pahari] 10093 Mus pahari gi|1195495225|ref|XP_021060492.1| XP_021060492 insulin-2 [Mus pahari] 10093 Mus pahari 110 1 58.9214 141 3.61433e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 247 gi|260874707|gb|ACX53313.1| ACX53313 insulin-2 precursor, partial [Mus musculus] 10090 Mus musculus 109 1 58.9214 141 3.64007e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 248 gi|159162405|pdb|1HIT|B 1HIT_B Chain B, Receptor Binding Redefined By A Structural Switch In A Mutant Human Insulin 9606 Homo sapiens 30 1 57.3806 137 3.6788e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGGFYTPKT FVNQHLCGSHLVEALYLVCGERG F TP T 249 gi|82749728|gb|ABB89748.1| ABB89748 preproinsulin 2 [Apodemus semotus] 105299 Apodemus semotus 110 1 58.9214 141 3.68954e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 250 gi|296219060|ref|XP_002755713.1| XP_002755713 PREDICTED: insulin [Callithrix jacchus] 9483 Callithrix jacchus 108 1 58.9214 141 3.70347e-09 27 28 14 51 17 54 38 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT WGPEPAPAFVNQHLCGPHLVEALYLVCGERGFFYAPKT + E FVNQHLCG HLVEALYLVCGERGFF P T 251 gi|505777947|ref|XP_004602925.1| XP_004602925 PREDICTED: insulin [Sorex araneus] 42254 Sorex araneus 101 1 58.5362 140 3.75508e-09 26 27 22 49 24 51 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGAHLVEALYLVCGERGFFYTP FVNQHLCG+HLVEALYLVCGERGFF TP 252 gi|32171953|sp|P01320.1|INS_CAMDR P01320 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9838 Camelus dromedarius 51 1 57.7658 138 3.81271e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FANQHLCGSHLVEALYLVCGERGFFYTPKA F NQHLCGSHLVEALYLVCGERGFF TP 253 gi|6680463|ref|NP_032413.1| NP_032413 insulin-2 preproprotein [Mus musculus] 10090 Mus musculus gi|297374794|ref|NP_001172012.1| NP_001172012 insulin-2 preproprotein [Mus musculus] 10090 Mus musculus gi|297374796|ref|NP_001172013.1| NP_001172013 insulin-2 preproprotein [Mus musculus] 10090 Mus musculus gi|124519|sp|P01326.1|INS2_MOUSE P01326 RecName: Full=Insulin-2; Contains: RecName: Full=Insulin-2 B chain; Contains: RecName: Full=Insulin-2 A chain; Flags: Precursor 10090 Mus musculus gi|52715|emb|CAA28433.1| CAA28433 preproinsulin II [Mus musculus] 10090 Mus musculus gi|12841261|dbj|BAB25135.1| BAB25135 unnamed protein product [Mus musculus] 10090 Mus musculus gi|59036776|gb|AAW83742.1| AAW83742 proinsulin [Mus musculus] 10090 Mus musculus gi|86989480|emb|CAJ76270.1| CAJ76270 insulin II [Mus spretus] 10096 Mus spretus gi|124375822|gb|AAI32651.1| AAI32651 Insulin II [Mus musculus] 10090 Mus musculus gi|124376522|gb|AAI32653.1| AAI32653 Insulin II [Mus musculus] 10090 Mus musculus gi|133777243|gb|AAH99934.1| AAH99934 Insulin II [Mus musculus] 10090 Mus musculus gi|148686232|gb|EDL18179.1| EDL18179 insulin II, isoform CRA_a [Mus musculus] 10090 Mus musculus gi|148686233|gb|EDL18180.1| EDL18180 insulin II, isoform CRA_a [Mus musculus] 10090 Mus musculus gi|219519431|gb|AAI45555.1| AAI45555 Insulin II [Mus musculus] 10090 Mus musculus gi|744259|prf||2014276B 2014276B insulin 10090 Mus musculus 110 1 58.9214 141 3.84468e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 254 gi|9506817|ref|NP_062003.1| NP_062003 insulin-2 preproprotein [Rattus norvegicus] 10116 Rattus norvegicus gi|124520|sp|P01323.1|INS2_RAT P01323 RecName: Full=Insulin-2; Contains: RecName: Full=Insulin-2 B chain; Contains: RecName: Full=Insulin-2 A chain; Flags: Precursor 10116 Rattus norvegicus gi|56490|emb|CAA24560.1| CAA24560 preproinsulin [Rattus norvegicus] 10116 Rattus norvegicus gi|204952|gb|AAA41440.1| AAA41440 insulin 2 [Rattus norvegicus] 10116 Rattus norvegicus gi|204959|gb|AAA41443.1| AAA41443 preproinsulin II [Rattus norvegicus] 10116 Rattus norvegicus gi|149061739|gb|EDM12162.1| EDM12162 rCG48472 [Rattus norvegicus] 10116 Rattus norvegicus 110 1 58.9214 141 3.84468e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 255 gi|1431691|pdb|1MHI|B 1MHI_B Chain B, THREE-DIMENSIONAL SOLUTION STRUCTURE OF AN INSULIN DIMER. A STUDY OF THE B9(ASP) MUTANT OF HUMAN INSULIN USING NUCLEAR MAGNETIC RESONANCE DISTANCE GEOMETRY AND RESTRAINED MOLECULAR DYNAMICS 9606 Homo sapiens 30 1 57.3806 137 3.87971e-09 26 26 23 51 2 30 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGDHLVEALYLVCGERGFFYTPKT VNQHLCG HLVEALYLVCGERGFF TP T 256 gi|82749730|gb|ABB89749.1| ABB89749 preproinsulin 2 [Mus caroli] 10089 Mus caroli 110 1 58.9214 141 4.00632e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 257 gi|190576611|gb|ACE79098.1| ACE79098 insulin precursor (predicted) [Sorex araneus] 42254 Sorex araneus 105 1 58.5362 140 4.06189e-09 26 27 22 49 24 51 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGAHLVEALYLVCGERGFFYTP FVNQHLCG+HLVEALYLVCGERGFF TP 258 gnl|mdb|bmrb2274:1 bmrb2274:1 insulin B chain 30 1 57.3806 137 4.13531e-09 26 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGXHLVEALYLVCGERGFFYTP FVNQHLCG HLVEALYLVCGERGFF TP 259 gi|226297|prf||1506296B 1506296B insulin B 9317 Macropus giganteus 30 1 57.3806 137 4.2242e-09 26 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP LVNQHLCGSHLVEALYLVCGERGFFYTP VNQHLCGSHLVEALYLVCGERGFF TP 260 gi|54037402|sp|P67972.1|INS_AOTTR P67972 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9505 Aotus trivirgatus gi|176556|gb|AAA35374.1| AAA35374 preproinsulin [Aotus trivirgatus] 9505 Aotus trivirgatus 108 1 58.5362 140 4.23465e-09 27 28 14 51 17 54 38 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT WGPEPAPAFVNQHLCGPHLVEALYLVCGERGFFYAPKT + E FVNQHLCG HLVEALYLVCGERGFF P T 261 gi|229392|prf||720460B 720460B insulin 2,pro 10116 Rattus norvegicus 86 1 58.151 139 4.26863e-09 26 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 262 gi|1134776109|pdb|5HPR|B 5HPR_B Chain B, Insulin With Proline Analog Hyp At Position B28 In The T2 State 9606 Homo sapiens gi|1134776111|pdb|5HPU|B 5HPU_B Chain B, Insulin with proline analog HyP at position B28 in the R6 state 9606 Homo sapiens gi|1134776113|pdb|5HPU|D 5HPU_D Chain D, Insulin with proline analog HyP at position B28 in the R6 state 9606 Homo sapiens gi|1134776118|pdb|5HQI|B 5HQI_B Chain B, Insulin With Proline Analog Hzp At Position B28 In The T2 State 9606 Homo sapiens gi|1134776132|pdb|5HRQ|B 5HRQ_B Chain B, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776134|pdb|5HRQ|D 5HRQ_D Chain D, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776136|pdb|5HRQ|F 5HRQ_F Chain F, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776138|pdb|5HRQ|H 5HRQ_H Chain H, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776140|pdb|5HRQ|J 5HRQ_J Chain J, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776142|pdb|5HRQ|L 5HRQ_L Chain L, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1345621795|pdb|5UOZ|B 5UOZ_B Chain B, Insulin with proline analog FyP at position B28 in the T2 state 9606 Homo sapiens gi|1345622634|pdb|5URT|B 5URT_B Chain B, Insulin with proline analog DhP at position B28 in the T2 state 9606 Homo sapiens gi|1347869624|pdb|5UQA|B 5UQA_B Chain B, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869626|pdb|5UQA|D 5UQA_D Chain D, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869628|pdb|5UQA|F 5UQA_F Chain F, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869630|pdb|5UQA|H 5UQA_H Chain H, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869632|pdb|5UQA|J 5UQA_J Chain J, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869634|pdb|5UQA|L 5UQA_L Chain L, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869637|pdb|5URU|B 5URU_B Chain B, Insulin with proline analog DhP at position B28 in the R6 state 9606 Homo sapiens gi|1347869639|pdb|5URU|D 5URU_D Chain D, Insulin with proline analog DhP at position B28 in the R6 state 9606 Homo sapiens gi|1347869641|pdb|5URU|F 5URU_F Chain F, Insulin with proline analog DhP at position B28 in the R6 state 9606 Homo sapiens gi|1347869643|pdb|5URU|H 5URU_H Chain H, Insulin with proline analog DhP at position B28 in the R6 state 9606 Homo sapiens gi|1347869657|pdb|5USP|B 5USP_B Chain B, Insulin with proline analog Pip at position B28 in the T2 state 9606 Homo sapiens gi|1347869659|pdb|5USS|B 5USS_B Chain B, Insulin with proline analog PiP at position B28 in the R6 state 9606 Homo sapiens gi|1347869661|pdb|5USS|D 5USS_D Chain D, Insulin with proline analog PiP at position B28 in the R6 state 9606 Homo sapiens gi|1347869663|pdb|5USV|B 5USV_B Chain B, Insulin with proline analog AzeP at position B28 in the T2 state 9606 Homo sapiens gi|1347869675|pdb|5UU2|B 5UU2_B Chain B, Insulin with proline analog ThioP at position B28 in the T2 state 9606 Homo sapiens gi|1347869677|pdb|5UU3|B 5UU3_B Chain B, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869679|pdb|5UU3|D 5UU3_D Chain D, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869681|pdb|5UU3|F 5UU3_F Chain F, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869683|pdb|5UU3|H 5UU3_H Chain H, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869685|pdb|5UU3|J 5UU3_J Chain J, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869687|pdb|5UU3|L 5UU3_L Chain L, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869689|pdb|5UU3|N 5UU3_N Chain N, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869691|pdb|5UU3|P 5UU3_P Chain P, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869693|pdb|5UU3|R 5UU3_R Chain R, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869695|pdb|5UU3|T 5UU3_T Chain T, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869697|pdb|5UU3|V 5UU3_V Chain V, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869699|pdb|5UU3|X 5UU3_X Chain X, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869701|pdb|5UU4|B 5UU4_B Chain B, Insulin with proline analog ThioP at position B28 in the R6 state 9606 Homo sapiens gi|1347869703|pdb|5UU4|D 5UU4_D Chain D, Insulin with proline analog ThioP at position B28 in the R6 state 9606 Homo sapiens 30 1 57.3806 137 4.31499e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTXKT FVNQHLCGSHLVEALYLVCGERGFF T T 263 gi|1633388|pdb|1LPH|B 1LPH_B Chain B, Lys(B28)pro(B29)-Human Insulin 9606 Homo sapiens gi|1633390|pdb|1LPH|D 1LPH_D Chain D, Lys(B28)pro(B29)-Human Insulin 9606 Homo sapiens gi|298508257|pdb|2KJJ|B 2KJJ_B Chain B, Dynamics of insulin probed by 1H-NMR amide proton exchange anomalous flexibility of the receptor-binding surface 9606 Homo sapiens gi|453055536|pdb|2M1D|B 2M1D_B Chain B, Biosynthetic engineered B28K-B29P human insulin monomer structure in in water/acetonitrile solutions. 9606 Homo sapiens gi|453055538|pdb|2M1E|B 2M1E_B Chain B, Biosynthetic engineered B28K-B29P human insulin monomer structure in in water solutions. 9606 Homo sapiens gi|1130619682|pdb|5UDP|B 5UDP_B Chain B, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619684|pdb|5UDP|D 5UDP_D Chain D, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619686|pdb|5UDP|F 5UDP_F Chain F, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619688|pdb|5UDP|H 5UDP_H Chain H, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619690|pdb|5UDP|J 5UDP_J Chain J, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619692|pdb|5UDP|L 5UDP_L Chain L, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens 30 1 57.3806 137 4.36112e-09 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTKPT FVNQHLCGSHLVEALYLVCGERGFF T T 264 gi|82749726|gb|ABB89747.1| ABB89747 preproinsulin 2 [Rattus losea] 69075 Rattus losea 110 1 58.5362 140 4.3952e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPVS FV QHLCGSHLVEALYLVCGERGFF TP + 265 gi|507709585|ref|XP_004717235.1| XP_004717235 PREDICTED: insulin [Echinops telfairi] 9371 Echinops telfairi 108 1 58.5362 140 4.41288e-09 27 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT IVNQHLCGSHLVEALYLVCGERGFFYTPKT VNQHLCGSHLVEALYLVCGERGFF TP T 266 gi|1195731531|ref|XP_021024412.1| XP_021024412 insulin-2 [Mus caroli] 10089 Mus caroli gi|1195731533|ref|XP_021024413.1| XP_021024413 insulin-2 [Mus caroli] 10089 Mus caroli 110 1 58.5362 140 4.53301e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 267 gi|1044423418|ref|XP_017363198.1| XP_017363198 PREDICTED: insulin [Cebus capucinus imitator] 1737458 Cebus capucinus imitator 108 1 58.5362 140 4.59859e-09 27 28 14 51 17 54 38 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT WGPEPAPAFVNQHLCGPHLVEALYLVCGERGFFYAPKT + E FVNQHLCG HLVEALYLVCGERGFF P T 268 gi|817282864|ref|XP_012311615.1| XP_012311615 insulin [Aotus nancymaae] 37293 Aotus nancymaae 108 1 58.5362 140 4.59859e-09 27 28 14 51 17 54 38 0 YQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT WGPEPAPAFVNQHLCGPHLVEALYLVCGERGFFYAPKT + E FVNQHLCG HLVEALYLVCGERGFF P T 269 gi|230591|pdb|2INS|B 2INS_B Chain B, THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN 9913 Bos taurus gi|230593|pdb|2INS|D 2INS_D Chain D, THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN 9913 Bos taurus 29 1 56.9954 136 4.66502e-09 26 26 23 49 1 27 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP VNQHLCGSHLVEALYLVCGERGFFYTP VNQHLCGSHLVEALYLVCGERGFF TP 270 gi|432099191|gb|ELK28556.1| ELK28556 Insulin [Myotis davidii] 225400 Myotis davidii 101 1 58.5362 140 4.71597e-09 25 27 22 49 40 67 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP YLNQHLCGSHLVEALYLVCGERGFFYTP ++NQHLCGSHLVEALYLVCGERGFF TP 271 gi|1189450107|pdb|5AZZ|B 5AZZ_B Chain B, Crystal Structure Of Seleno-insulin 9913 Bos taurus 31 1 56.9954 136 4.94129e-09 26 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLXGSHLVEALYLVCGERGFFYTP FVNQHL GSHLVEALYLVCGERGFF TP 272 gi|725605675|ref|XP_010329449.1| XP_010329449 PREDICTED: insulin [Saimiri boliviensis boliviensis] 39432 Saimiri boliviensis boliviensis 108 1 58.5362 140 4.94251e-09 27 27 17 51 20 54 35 0 ENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT EPAPAFVNQHLCGPHLVEALYLVCGERGFFYAPKT E FVNQHLCG HLVEALYLVCGERGFF P T 273 gi|1190445892|ref|XP_020826540.1| XP_020826540 insulin [Phascolarctos cinereus] 38626 Phascolarctos cinereus 103 1 58.5362 140 4.95585e-09 26 26 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP LVNQHLCGSHLVEALYLVCGERGFFYTP VNQHLCGSHLVEALYLVCGERGFF TP 274 gi|82749732|gb|ABB89750.1| ABB89750 preproinsulin 2 [Niviventer coninga] 357352 Niviventer coninga 110 1 58.5362 140 5.18169e-09 26 27 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGSHLVEALYLVCGERGFFYTPMS FV QHLCGSHLVEALYLVCGERGFF TP + 275 gi|504181505|ref|XP_004599268.1| XP_004599268 PREDICTED: insulin isoform X1 [Ochotona princeps] 9978 Ochotona princeps 104 1 58.151 139 5.51647e-09 26 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYMPKA FVNQHLCGSHLVEALYLVCGERGFF P 276 gi|504181507|ref|XP_004599269.1| XP_004599269 PREDICTED: insulin isoform X2 [Ochotona princeps] 9978 Ochotona princeps 101 1 58.151 139 5.62321e-09 26 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYMPKA FVNQHLCGSHLVEALYLVCGERGFF P 277 gi|54037399|sp|P67971.1|INS_SAISC P67971 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9521 Saimiri sciureus gi|538566|pir||INMKSQ INMKSQ insulin - common squirrel monkey 9521 Saimiri sciureus 51 1 57.3806 137 5.88549e-09 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGPHLVEALYLVCGERGFFYAPKT FVNQHLCG HLVEALYLVCGERGFF P T 278 gi|594635596|ref|XP_007171218.1| XP_007171218 PREDICTED: LOW QUALITY PROTEIN: insulin [Balaenoptera acutorostrata scammoni] 310752 Balaenoptera acutorostrata scammoni 113 1 58.151 139 6.21784e-09 26 27 22 51 28 57 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVSQHLCGSHLVEALYLVCGERGFFYTPKA FV+QHLCGSHLVEALYLVCGERGFF TP 279 gi|586552037|ref|XP_006911039.1| XP_006911039 insulin [Pteropus alecto] 9402 Pteropus alecto gi|431910135|gb|ELK13208.1| ELK13208 Insulin [Pteropus alecto] 9402 Pteropus alecto 110 1 58.151 139 6.56399e-09 26 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVSQHLCGSHLVEALYLVCGERGFFYTP FV+QHLCGSHLVEALYLVCGERGFF TP 280 gi|5542375|pdb|1QIY|D 1QIY_D Chain D, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542387|pdb|1QIZ|D 1QIZ_D Chain D, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens 30 1 56.6102 135 6.96164e-09 26 27 23 51 2 30 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQYLCGSHLVEALYLVCGERGFFYTPKT VNQ+LCGSHLVEALYLVCGERGFF TP T 281 gi|32172013|sp|P18109.1|INS_DIDVI P18109 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9267 Didelphis virginiana 51 1 56.9954 136 7.35028e-09 26 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP LVNQHLCGSHLVEALYLVCGERGFFYTP VNQHLCGSHLVEALYLVCGERGFF TP 282 gi|32891823|gb|AAP45949.1| AAP45949 preproinsulin, partial [Anas crecca] 75839 Anas crecca gi|32891825|gb|AAP45950.1| AAP45950 preproinsulin, partial [Anas platyrhynchos] 8839 Anas platyrhynchos gi|32891827|gb|AAP45951.1| AAP45951 preproinsulin, partial [Anas platyrhynchos] 8839 Anas platyrhynchos gi|32891831|gb|AAP45953.1| AAP45953 preproinsulin, partial [Cairina moschata] 8855 Cairina moschata gi|32891873|gb|AAP45974.1| AAP45974 preproinsulin, partial [Tadorna tadorna] 75865 Tadorna tadorna 55 1 56.9954 136 7.69525e-09 25 26 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKT NQHLCGSHLVEALYLVCGERGFF +P T 283 gi|985483924|pdb|5BQQ|B 5BQQ_B Chain B, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483926|pdb|5BQQ|D 5BQQ_D Chain D, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483928|pdb|5BQQ|F 5BQQ_F Chain F, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483930|pdb|5BQQ|H 5BQQ_H Chain H, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483932|pdb|5BQQ|J 5BQQ_J Chain J, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483934|pdb|5BQQ|L 5BQQ_L Chain L, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens 30 1 56.6102 135 8.16441e-09 26 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYXP FVNQHLCGSHLVEALYLVCGERGFF P 284 gi|1699408|gb|AAB37515.1| AAB37515 insulin B chain [Cairina moschata] 8855 Cairina moschata 30 1 56.6102 135 8.16441e-09 25 26 23 51 2 30 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKT NQHLCGSHLVEALYLVCGERGFF +P T 285 gi|82749718|gb|ABB89743.1| ABB89743 preproinsulin 1 [Rattus losea] 69075 Rattus losea 110 1 57.7658 138 8.39913e-09 25 32 9 51 12 54 43 0 SICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT ALLVVWEPKPAQAFVKQHLCGPHLVEALYLVCGERGFFYTPKS ++ +++ + FV QHLCG HLVEALYLVCGERGFF TP + 286 gi|640785517|ref|XP_008048481.1| XP_008048481 insulin-like, partial [Carlito syrichta] 1868482 Carlito syrichta 150 1 58.5362 140 8.4429e-09 25 25 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGPHLVEALYLVCGERGFFYAP FVNQHLCG HLVEALYLVCGERGFF P 287 gi|1279526624|pdb|5WBT|A 5WBT_A Chain A, Solution Structure and Dynamics of an Ultra-Stable Single-Chain Insulin Analog STUDIES OF AN ENGINEERED MONOMER AND IMPLICATIONS FOR RECEPTOR BINDING 9606 Homo sapiens 57 1 56.6102 135 1.07015e-08 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTDPT FVNQHLCGSHLVEALYLVCGERGFF T T 288 gnl|mdb|bmrb30314:1 bmrb30314:1 Insulin 57 1 56.6102 135 1.07015e-08 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYTDPT FVNQHLCGSHLVEALYLVCGERGFF T T 289 gi|345111089|pdb|3ZS2|B 3ZS2_B Chain B, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111091|pdb|3ZS2|D 3ZS2_D Chain D, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111093|pdb|3ZS2|F 3ZS2_F Chain F, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111095|pdb|3ZS2|H 3ZS2_H Chain H, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111097|pdb|3ZS2|J 3ZS2_J Chain J, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111099|pdb|3ZS2|L 3ZS2_L Chain L, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens 30 1 56.225 134 1.1228e-08 27 28 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFYXTKPT FVNQHLCGSHLVEALYLVCGERGF+XT T 290 gi|159162418|pdb|1HO0|A 1HO0_A Chain A, New B-Chain Mutant Of Bovine Insulin 32630 synthetic construct 30 1 56.225 134 1.15915e-08 25 25 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLSGSHLVEALYLVSGERGFFYTP FVNQHL GSHLVEALYLV GERGFF TP 291 gi|82749724|gb|ABB89746.1| ABB89746 preproinsulin 1 [Niviventer coninga] 357352 Niviventer coninga 110 1 57.3806 137 1.19054e-08 25 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYTPKS FV QHLCG HLVEALYLVCGERGFF TP + 292 gi|9506815|ref|NP_062002.1| NP_062002 insulin-1 preproprotein [Rattus norvegicus] 10116 Rattus norvegicus gi|124512|sp|P01322.1|INS1_RAT P01322 RecName: Full=Insulin-1; Contains: RecName: Full=Insulin-1 B chain; Contains: RecName: Full=Insulin-1 A chain; Flags: Precursor 10116 Rattus norvegicus gi|56488|emb|CAA24559.1| CAA24559 insulin I [Rattus norvegicus] 10116 Rattus norvegicus gi|204948|gb|AAA41439.1| AAA41439 insulin 1 [Rattus norvegicus] 10116 Rattus norvegicus gi|204957|gb|AAA41442.1| AAA41442 preproinsulin I [Rattus norvegicus] 10116 Rattus norvegicus gi|149040369|gb|EDL94407.1| EDL94407 rCG57481, isoform CRA_b [Rattus norvegicus] 10116 Rattus norvegicus 110 1 57.3806 137 1.27912e-08 25 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYTPKS FV QHLCG HLVEALYLVCGERGFF TP + 293 gi|4558198|pdb|1ZEI|A 1ZEI_A Chain A, Cross-Linked B28 Asp Insulin 9823 Sus scrofa gi|4558199|pdb|1ZEI|B 1ZEI_B Chain B, Cross-Linked B28 Asp Insulin 9823 Sus scrofa gi|4558200|pdb|1ZEI|C 1ZEI_C Chain C, Cross-Linked B28 Asp Insulin 9823 Sus scrofa gi|4558201|pdb|1ZEI|D 1ZEI_D Chain D, Cross-Linked B28 Asp Insulin 9823 Sus scrofa gi|4558202|pdb|1ZEI|E 1ZEI_E Chain E, Cross-Linked B28 Asp Insulin 9823 Sus scrofa gi|4558203|pdb|1ZEI|F 1ZEI_F Chain F, Cross-Linked B28 Asp Insulin 9823 Sus scrofa 53 1 56.225 134 1.28904e-08 26 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFFYTD FVNQHLCGSHLVEALYLVCGERGFF T 294 gi|60672440|gb|AAX33326.1| AAX33326 insulin, partial [Chinchilla chinchilla] 10152 Chinchilla brevicaudata gi|60672442|gb|AAX33327.1| AAX33327 insulin, partial [Chinchilla lanigera] 34839 Chinchilla lanigera 51 1 56.225 134 1.43101e-08 24 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNKHLCGSHLVDALYLVCGDRGFFYTP FVN+HLCGSHLV+ALYLVCG+RGFF TP 295 gi|229391|prf||720460A 720460A insulin 1,pro 10116 Rattus norvegicus 86 1 56.9954 136 1.49232e-08 25 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYTPKS FV QHLCG HLVEALYLVCGERGFF TP + 296 gi|117606345|ref|NP_032412.3| NP_032412 insulin-1 preproprotein [Mus musculus] 10090 Mus musculus gi|124511|sp|P01325.1|INS1_MOUSE P01325 RecName: Full=Insulin-1; Contains: RecName: Full=Insulin-1 B chain; Contains: RecName: Full=Insulin-1 A chain; Flags: Precursor 10090 Mus musculus gi|52713|emb|CAA28434.1| CAA28434 unnamed protein product [Mus musculus] 10090 Mus musculus gi|12840833|dbj|BAB24974.1| BAB24974 unnamed protein product [Mus musculus] 10090 Mus musculus gi|12842500|dbj|BAB25628.1| BAB25628 unnamed protein product [Mus musculus] 10090 Mus musculus gi|71051638|gb|AAH98468.1| AAH98468 Insulin I [Mus musculus] 10090 Mus musculus gi|74138255|dbj|BAE28611.1| BAE28611 unnamed protein product [Mus musculus] 10090 Mus musculus gi|94962391|gb|ABF48502.1| ABF48502 insulin 1 precursor [Mus musculus] 10090 Mus musculus gi|148669735|gb|EDL01682.1| EDL01682 insulin I, isoform CRA_a [Mus musculus] 10090 Mus musculus gi|148669736|gb|EDL01683.1| EDL01683 insulin I, isoform CRA_a [Mus musculus] 10090 Mus musculus gi|148877644|gb|AAI45869.1| AAI45869 Insulin I [Mus musculus] 10090 Mus musculus gi|148877646|gb|AAI45871.1| AAI45871 Insulin I [Mus musculus] 10090 Mus musculus gi|1004711801|gb|AMP56504.1| AMP56504 insulin/IGF/Relaxin family [uncultured bacterium] 77133 uncultured bacterium gi|1004711836|gb|AMP56525.1| AMP56525 insulin/IGF/Relaxin family [uncultured bacterium] 77133 uncultured bacterium gi|1004711946|gb|AMP56593.1| AMP56593 insulin/IGF/Relaxin family [uncultured bacterium] 77133 uncultured bacterium gi|1004711977|gb|AMP56611.1| AMP56611 insulin/IGF/Relaxin family [uncultured bacterium] 77133 uncultured bacterium gi|744258|prf||2014276A 2014276A insulin 10090 Mus musculus 108 1 56.9954 136 1.54722e-08 25 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYTPKS FV QHLCG HLVEALYLVCGERGFF TP + 297 gi|533139014|ref|XP_005384246.1| XP_005384246 PREDICTED: insulin [Chinchilla lanigera] 34839 Chinchilla lanigera 110 1 57.3806 137 1.55405e-08 24 27 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNKHLCGSHLVDALYLVCGDRGFFYTP FVN+HLCGSHLV+ALYLVCG+RGFF TP 298 gi|14488761|pdb|1HTV|B 1HTV_B Chain B, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488763|pdb|1HTV|D 1HTV_D Chain D, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488765|pdb|1HTV|F 1HTV_F Chain F, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488767|pdb|1HTV|H 1HTV_H Chain H, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488769|pdb|1HTV|J 1HTV_J Chain J, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488771|pdb|1HTV|L 1HTV_L Chain L, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens 27 1 55.8398 133 1.61656e-08 26 26 22 48 1 27 27 0 FVNQHLCGSHLVEALYLVCGERGFFXT FVNQHLCGSHLVEALYLVCGERGFFYT FVNQHLCGSHLVEALYLVCGERGFF T 299 gi|149040367|gb|EDL94405.1| EDL94405 rCG57477 [Rattus norvegicus] 10116 Rattus norvegicus 117 1 57.3806 137 1.6519e-08 25 26 22 51 32 61 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYTPKS FV QHLCG HLVEALYLVCGERGFF TP + 300 gi|1195497129|ref|XP_021070669.1| XP_021070669 insulin-1 [Mus pahari] 10093 Mus pahari 110 1 56.9954 136 1.7041e-08 25 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYTPKS FV QHLCG HLVEALYLVCGERGFF TP + 301 gi|675082457|pdb|4NIB|B 4NIB_B Chain B, Crystal Structure Of Human Insulin Mutant B20 D-ala, B23 D-ala 9606 Homo sapiens 30 1 55.8398 133 1.73507e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCXERXFFYTPKT FVNQHLCGSHLVEALYLVC ER FF TP T 302 gnl|mdb|bmrb1017:1 bmrb1017:1 insulin B chain 30 1 55.8398 133 1.77229e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALELVCGERGFFYEPKT FVNQHLCGSHLVEAL LVCGERGFF P T 303 gnl|mdb|bmrb1019:1 bmrb1019:1 insulin B chain 30 1 55.8398 133 1.77229e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALELVCGERGFFYEPKT FVNQHLCGSHLVEAL LVCGERGFF P T 304 gi|82749720|gb|ABB89744.1| ABB89744 preproinsulin 1 [Apodemus semotus] 105299 Apodemus semotus 110 1 56.9954 136 1.79361e-08 25 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYTPKS FV QHLCG HLVEALYLVCGERGFF TP + 305 gi|83303940|sp|P01327.2|INS_CHICH P01327 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 10152 Chinchilla brevicaudata 86 1 56.6102 135 1.87633e-08 24 27 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNKHLCGSHLVDALYLVCGDRGFFYTP FVN+HLCGSHLV+ALYLVCG+RGFF TP 306 gi|32891875|gb|AAP45975.1| AAP45975 preproinsulin, partial [Turdus merula] 9187 Turdus merula 55 1 55.8398 133 1.90814e-08 25 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 307 gi|159162694|pdb|1MHJ|B 1MHJ_B Chain B, SOLUTION STRUCTURE OF THE SUPERACTIVE MONOMERIC DES-[PHE(B25)] HUMAN INSULIN MUTANT. ELUCIDATION OF THE STRUCTURAL BASIS FOR THE MONOMERIZATION OF THE DES-[PHE(B25)] INSULIN AND THE DIMERIZATION OF NATIVE INSULIN 9606 Homo sapiens 29 1 55.4546 132 1.99918e-08 27 28 22 51 1 29 30 1 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFY-TPKT FVNQHLCGSHLVEALYLVCGERGF+ TP T 308 gi|32891857|gb|AAP45966.1| AAP45966 preproinsulin, partial [Passer domesticus] 48849 Passer domesticus 55 1 55.8398 133 2.03283e-08 25 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 309 gi|32891839|gb|AAP45957.1| AAP45957 preproinsulin, partial [Dromaius novaehollandiae] 8790 Dromaius novaehollandiae 55 1 55.8398 133 2.05438e-08 24 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 310 gi|60392458|sp|P68243.1|INS_CAIMO P68243 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8855 Cairina moschata gi|60392461|sp|P68245.1|INS_ANSAN P68245 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8844 Anser anser anser 51 1 55.8398 133 2.07126e-08 25 26 23 51 2 30 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKT NQHLCGSHLVEALYLVCGERGFF +P T 311 gi|63530|emb|CAA23707.1| CAA23707 unnamed protein product, partial [Gallus gallus] 9031 Gallus gallus 62 1 55.8398 133 2.14761e-08 24 25 23 49 26 52 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGERGFFYSP NQHLCGSHLVEALYLVCGERGFF +P 312 gi|159162548|pdb|1JCO|B 1JCO_B Chain B, Solution Structure Of The Monomeric [thr(B27)->pro,Pro(B28)- >thr] Insulin Mutant (Pt Insulin) 9606 Homo sapiens 30 1 55.4546 132 2.43643e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGFFYPTKT FVNQHLCGSHLVEALYLVCGERGFF T 313 gi|45476809|sp|P83770.1|INSL_VIGUN P83770 RecName: Full=Insulin-like protein; Contains: RecName: Full=Insulin-like protein B chain; Contains: RecName: Full=Insulin-like protein A chain 3917 Vigna unguiculata 51 1 55.4546 132 2.47855e-08 25 25 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLXGSHLVEALYLVXGERGFFYTP FVNQHL GSHLVEALYLV GERGFF TP 314 gi|902917249|ref|XP_013047074.1| XP_013047074 PREDICTED: insulin [Anser cygnoides domesticus] 381198 Anser cygnoides domesticus 107 1 56.6102 135 2.85563e-08 25 26 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKT NQHLCGSHLVEALYLVCGERGFF +P T 315 gi|32891835|gb|AAP45955.1| AAP45955 preproinsulin, partial [Columba livia] 8932 Columba livia gi|32891847|gb|AAP45961.1| AAP45961 preproinsulin, partial [Gallus gallus] 9031 Gallus gallus gi|32891849|gb|AAP45962.1| AAP45962 preproinsulin, partial [Meleagris gallopavo] 9103 Meleagris gallopavo 55 1 55.4546 132 2.87894e-08 24 25 23 49 19 45 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGERGFFYSP NQHLCGSHLVEALYLVCGERGFF +P 316 gi|32891833|gb|AAP45954.1| AAP45954 preproinsulin, partial [Ciconia ciconia] 8928 Ciconia ciconia gi|32891837|gb|AAP45956.1| AAP45956 preproinsulin, partial [Thalassarche melanophrys] 54026 Thalassarche melanophrys gi|32891853|gb|AAP45964.1| AAP45964 preproinsulin, partial [Nycticorax nycticorax hoactli] 230836 Nycticorax nycticorax hoactli 55 1 55.4546 132 2.87894e-08 24 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 317 gi|32891869|gb|AAP45972.1| AAP45972 preproinsulin, partial [Struthio camelus] 8801 Struthio camelus 55 1 55.4546 132 2.90945e-08 24 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 318 gi|32891859|gb|AAP45967.1| AAP45967 preproinsulin, partial [Phaethon aethereus] 37045 Phaethon aethereus gi|32891865|gb|AAP45970.1| AAP45970 preproinsulin, partial [Rissa tridactyla] 75485 Rissa tridactyla gi|32891877|gb|AAP45976.1| AAP45976 preproinsulin, partial [Uria aalge] 13746 Uria aalge 55 1 55.4546 132 2.90945e-08 24 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 319 gi|32891867|gb|AAP45971.1| AAP45971 preproinsulin, partial [Strix aluco] 111821 Strix aluco 55 1 55.4546 132 2.90945e-08 24 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 320 gi|1197333171|ref|XP_021128209.1| XP_021128209 insulin [Anas platyrhynchos] 8839 Anas platyrhynchos gi|483512995|gb|EOB01264.1| EOB01264 Insulin, partial [Anas platyrhynchos] 8839 Anas platyrhynchos 107 1 56.225 134 2.91473e-08 25 26 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKT NQHLCGSHLVEALYLVCGERGFF +P T 321 gi|32891871|gb|AAP45973.1| AAP45973 preproinsulin, partial [Sula sula] 57662 Sula sula 55 1 55.4546 132 3.00293e-08 24 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 322 gi|32891829|gb|AAP45952.1| AAP45952 preproinsulin, partial [Aptenodytes forsteri] 9233 Aptenodytes forsteri gi|32891843|gb|AAP45959.1| AAP45959 preproinsulin, partial [Fulmarus glacialis] 30455 Fulmarus glacialis gi|32891855|gb|AAP45965.1| AAP45965 preproinsulin, partial [Pagodroma nivea] 52126 Pagodroma nivea 55 1 55.4546 132 3.0669e-08 24 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 323 gi|701425737|ref|XP_010002178.1| XP_010002178 PREDICTED: insulin [Chaetura pelagica] 8897 Chaetura pelagica gi|678119345|gb|KFU94352.1| KFU94352 Insulin [Chaetura pelagica] 8897 Chaetura pelagica 107 1 56.225 134 3.3297e-08 25 26 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYSPKA VNQHLCGSHLVEALYLVCGERGFF +P 324 gi|383875505|pdb|3U4N|B 3U4N_B Chain B, A Novel Covalently Linked Insulin Dimer 9606 Homo sapiens 29 1 55.0694 131 3.47039e-08 26 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYLVCGERGFCYTP FVNQHLCGSHLVEALYLVCGERGF TP 325 gi|124615|sp|P21563.1|INS_RODSP P21563 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 69158 Rodentia sp. gi|102414|pir||S09278 S09278 insulin precursor - Geodia cydonium 6047 Geodia cydonium 108 1 56.225 134 3.47516e-08 27 28 22 51 24 54 31 1 FVNQHLCGSHLVEALY-LVCGERGFFXTPXT FVNQHLCGSHLVEALYILVCGERGFFYTPMS FVNQHLCGSHLVEALY LVCGERGFF TP + 326 gi|985483658|pdb|2N2X|B 2N2X_B Chain B, Solution structure of [GlyB24,B27-B29 triazole cross-linked]-insulin analogue at pH 1.9 30 1 55.0694 131 3.49398e-08 27 27 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGERGGFYXPXT FVNQHLCGSHLVEALYLVCGERG F PXT 327 gi|1195703069|ref|XP_021008173.1| XP_021008173 insulin-1 [Mus caroli] 10089 Mus caroli 108 1 56.225 134 3.51088e-08 24 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYSPKS FV QHLCG HLVEALYLVCGERGFF +P + 328 gi|82749722|gb|ABB89745.1| ABB89745 preproinsulin 1 [Mus caroli] 10089 Mus caroli 108 1 56.225 134 3.58342e-08 24 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVEALYLVCGERGFFYSPKS FV QHLCG HLVEALYLVCGERGFF +P + 329 gi|32172028|sp|P81423.1|INS_ACIGU P81423 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7902 Acipenser gueldenstaedtii gi|7438595|pir||S44470 S44470 insulin I2 - North American paddlefish (Polyodon spathula) 7913 Polyodon spathula 52 1 55.0694 131 3.64414e-08 25 25 23 49 2 28 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGERGFFYTP NQHLCGSHLVEALYLVCGERGFF TP 330 gi|927028764|dbj|BAS32719.1| BAS32719 insulin, partial [Plestiodon finitimus] 1054201 Plestiodon finitimus 98 1 55.8398 133 3.6787e-08 24 26 22 51 16 45 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FPNQHLCGSHLVEALYLVCGERGFYYSPKA F NQHLCGSHLVEALYLVCGERGF+ +P 331 gi|124547|sp|P01333.1|INS_ANAPL P01333 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 8839 Anas platyrhynchos 81 1 55.8398 133 3.70767e-08 25 26 23 51 2 30 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKT NQHLCGSHLVEALYLVCGERGFF +P T 332 gi|960999430|ref|XP_014815432.1| XP_014815432 PREDICTED: insulin [Calidris pugnax] 198806 Philomachus pugnax 107 1 56.225 134 3.76476e-08 25 26 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYSPKA VNQHLCGSHLVEALYLVCGERGFF +P 333 gi|60672458|gb|AAX33335.1| AAX33335 insulin, partial [Dasyprocta punctata] 34846 Dasyprocta punctata 51 1 55.0694 131 3.86096e-08 23 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALYMACGDKGFFYTP FVNQHLCGSHLVEALY+ CG++GFF TP 334 gi|663244949|ref|XP_008502921.1| XP_008502921 PREDICTED: insulin [Calypte anna] 9244 Calypte anna gi|676767125|gb|KFO96737.1| KFO96737 hypothetical protein N300_06482 [Calypte anna] 9244 Calypte anna 107 1 56.225 134 3.96233e-08 25 26 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYSPKA VNQHLCGSHLVEALYLVCGERGFF +P 335 gi|927028768|dbj|BAS32721.1| BAS32721 insulin, partial [Takydromus tachydromoides] 118850 Takydromus tachydromoides 98 1 55.8398 133 4.07778e-08 24 26 24 51 18 45 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQHLCGSHLVEALYLVCGERGFYYSPKT NQHLCGSHLVEALYLVCGERGF+ +P T 336 gi|1708499|sp|P51463.1|INS_SELRF P51463 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 29060 Selasphorus rufus gi|451262|gb|AAC64211.1| AAC64211 preproinsulin, partial [Selasphorus rufus] 29060 Selasphorus rufus 103 1 55.8398 133 4.13555e-08 25 26 23 51 22 50 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYSPKA VNQHLCGSHLVEALYLVCGERGFF +P 337 gi|159162579|pdb|1K3M|B 1K3M_B Chain B, Nmr Structure Of Human Insulin Mutant Ile-A2-Ala, His-B10- Asp, Pro-B28-Lys, Lys-B29-Pro, 15 Structures 32630 synthetic construct gi|159162611|pdb|1KMF|B 1KMF_B Chain B, NMR STRUCTURE OF HUMAN INSULIN MUTANT ILE-A2-ALLO-ILE, HIS-B10-ASP, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES gi|159162651|pdb|1LKQ|B 1LKQ_B Chain B, NMR STRUCTURE OF HUMAN INSULIN MUTANT ILE-A2-GLY, VAL-A3-GLY, HIS-B10-ASP, PRO-B28-LYS, LYS-B29-PRO, 20 STRUCTURES gi|159163244|pdb|1VKT|B 1VKT_B Chain B, Human Insulin Two Disulfide Model, Nmr, 10 Structures 9606 Homo sapiens gi|159164701|pdb|2JMN|B 2JMN_B Chain B, NMR structure of human insulin mutant His-B10-Asp, Pro-B28-Lys, Lys-B29-Pro, 20 structures 9606 Homo sapiens gi|159164731|pdb|2JUM|B 2JUM_B Chain B, ThrA3-DKP-insulin gi|159164733|pdb|2JUU|B 2JUU_B Chain B, allo-ThrA3 DKP-insulin gi|159164735|pdb|2JUV|B 2JUV_B Chain B, AbaA3-DKP-insulin gi|345110697|pdb|2L1Z|B 2L1Z_B Chain B, NMR Structure of human insulin mutant GLY-B20-D-ALA, GLY-B23-D-ALA PRO-B28-LYS, LYS-B29-PRO, 20 Structures 9606 Homo sapiens gi|449802759|pdb|4IUZ|B 4IUZ_B Chain B, High Resolution Crystal Structure Of Racemic Ester Insulin 9606 Homo sapiens 30 1 54.6842 130 4.18378e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGFFYTKPT FVNQHLCGS LVEALYLVCGERGFF T T 338 gnl|mdb|bmrb1760:1 bmrb1760:1 insulin B chain 30 1 54.6842 130 4.18378e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGFFYTKPT FVNQHLCGS LVEALYLVCGERGFF T T 339 gnl|mdb|bmrb1762:1 bmrb1762:1 insulin B chain 30 1 54.6842 130 4.18378e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGFFYTKPT FVNQHLCGS LVEALYLVCGERGFF T T 340 gi|459358633|pdb|4EFX|B 4EFX_B Chain B, Highly Biologically Active Insulin With Additional Disulfide Bond 9606 Homo sapiens gi|459358635|pdb|4EFX|D 4EFX_D Chain D, Highly Biologically Active Insulin With Additional Disulfide Bond 9606 Homo sapiens 28 1 54.6842 130 4.22018e-08 26 26 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNCHLCGSHLVEALYLVCGERGFFYTP FVN HLCGSHLVEALYLVCGERGFF TP 341 gi|651207478|pdb|2MPG|B 2MPG_B Chain B, Solution structure of the [AibB8,LysB28,ProB29]-insulin analogue 9606 Homo sapiens 30 1 54.6842 130 4.36493e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCXSHLVEALYLVCGERGFFYTKPT FVNQHLC SHLVEALYLVCGERGFF T T 342 gi|12841054|dbj|BAB25058.1| BAB25058 unnamed protein product [Mus musculus] 10090 Mus musculus 108 1 55.8398 133 4.67403e-08 24 26 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVKQHLCGPHLVKALYLVCGERGFFYTPKS FV QHLCG HLV+ALYLVCGERGFF TP + 343 gi|1012015786|ref|XP_016005239.1| XP_016005239 PREDICTED: insulin isoform X1 [Rousettus aegyptiacus] 9407 Rousettus aegyptiacus 112 1 55.8398 133 4.99138e-08 24 26 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVTQHLCGSHLVEALYVVCGERGFFYSP FV QHLCGSHLVEALY+VCGERGFF +P 344 gi|1176284540|ref|XP_020644463.1| XP_020644463 insulin [Pogona vitticeps] 103695 Pogona vitticeps 107 1 55.8398 133 5.06423e-08 24 26 24 51 27 54 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQHLCGSHLVEALYLVCGERGFYYSPKT NQHLCGSHLVEALYLVCGERGF+ +P T 345 gi|1012015792|ref|XP_016005248.1| XP_016005248 PREDICTED: insulin isoform X2 [Rousettus aegyptiacus] 9407 Rousettus aegyptiacus 111 1 55.8398 133 5.46588e-08 24 26 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVTQHLCGSHLVEALYVVCGERGFFYSP FV QHLCGSHLVEALY+VCGERGFF +P 346 gi|194462439|gb|ACF72675.1| ACF72675 insulin, partial [Xenopus tropicalis] 8364 Xenopus (Silurana) tropicalis 62 1 54.6842 130 5.70778e-08 25 27 13 49 15 51 37 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP LFSTPNTEALANQHLCGSHLVEALYLVCGDRGFFYYP L+ N NQHLCGSHLVEALYLVCG+RGFF P 347 gi|1338733773|ref|XP_023680902.1| XP_023680902 insulin isoform X2 [Paramormyrops kingsleyae] 1676925 Paramormyrops kingsleyae 103 1 55.4546 132 6.04308e-08 24 25 23 51 25 53 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALFLVCGERGFFFNPDT NQHLCGSHLVEAL+LVCGERGFF P T 348 gi|1338733771|ref|XP_023680891.1| XP_023680891 insulin isoform X1 [Paramormyrops kingsleyae] 1676925 Paramormyrops kingsleyae 110 1 55.4546 132 6.23402e-08 24 25 23 51 25 53 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALFLVCGERGFFFNPDT NQHLCGSHLVEAL+LVCGERGFF P T 349 gi|700386936|ref|XP_009933593.1| XP_009933593 PREDICTED: insulin [Opisthocomus hoazin] 30419 Opisthocomus hoazin gi|677550918|gb|KFR11290.1| KFR11290 Insulin [Opisthocomus hoazin] 30419 Opisthocomus hoazin 107 1 55.4546 132 6.27577e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 350 gi|543278264|ref|XP_005427262.1| XP_005427262 PREDICTED: insulin [Geospiza fortis] 48883 Geospiza fortis 107 1 55.4546 132 6.27577e-08 25 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 351 gi|542155617|ref|XP_005486624.1| XP_005486624 PREDICTED: insulin [Zonotrichia albicollis] 44394 Zonotrichia albicollis 107 1 55.4546 132 6.27577e-08 25 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 352 gi|591376720|ref|XP_007063026.1| XP_007063026 PREDICTED: insulin [Chelonia mydas] 8469 Chelonia mydas gi|465971798|gb|EMP32845.1| EMP32845 Insulin [Chelonia mydas] 8469 Chelonia mydas 107 1 55.4546 132 6.34017e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 353 gi|288562795|pdb|2WS4|B 2WS4_B Chain B, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti In Monomer Form 9606 Homo sapiens gi|288562809|pdb|2WS7|B 2WS7_B Chain B, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562811|pdb|2WS7|D 2WS7_D Chain D, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562813|pdb|2WS7|F 2WS7_F Chain F, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562815|pdb|2WS7|H 2WS7_H Chain H, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562817|pdb|2WS7|J 2WS7_J Chain J, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562819|pdb|2WS7|L 2WS7_L Chain L, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens 26 1 54.299 129 6.53181e-08 25 25 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF FVNQHLCGSHLVEALYLVCGERGFF FVNQHLCGSHLVEALYLVCGERGFF 354 gi|1942947|pdb|1PID|B 1PID_B Chain B, Bovine Despentapeptide Insulin 9913 Bos taurus gi|1942949|pdb|1PID|D 1PID_D Chain D, Bovine Despentapeptide Insulin 9913 Bos taurus gi|93279099|pdb|2CEU|B 2CEU_B Chain B, Despentapeptide Insulin In Acetic Acid (Ph 2) 9606 Homo sapiens gi|93279101|pdb|2CEU|D 2CEU_D Chain D, Despentapeptide Insulin In Acetic Acid (Ph 2) 9606 Homo sapiens gi|159162403|pdb|1HIS|B 1HIS_B Chain B, Structure And Dynamics Of Des-Pentapeptide-Insulin In Solution: The Molten-Globule Hypothesis. 9606 Homo sapiens 25 1 54.299 129 6.65637e-08 25 25 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF FVNQHLCGSHLVEALYLVCGERGFF FVNQHLCGSHLVEALYLVCGERGFF 355 gnl|mdb|bmrb937:1 bmrb937:1 insulin B chain 25 1 54.299 129 6.65637e-08 25 25 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF FVNQHLCGSHLVEALYLVCGERGFF FVNQHLCGSHLVEALYLVCGERGFF 356 gi|5107540|pdb|1BZV|B 1BZV_B Chain B [D-ALAB26]-DES(B27-B30)-INSULIN-B26-AMIDE A SUPERPOTENT SINGLE-REPLACEMENT INSULIN ANALOGUE, NMR, MINIMIZED AVERAGE STRUCTURE 32630 synthetic construct gi|288562781|pdb|2WRU|B 2WRU_B Chain B, Semi-synthetic Highly Active Analogue Of Human Insulin Nmealab26-dti-nh2 9606 Homo sapiens gi|288562783|pdb|2WRV|B 2WRV_B Chain B, Semi-synthetic Highly Active Analogue Of Human Insulin Nmehisb26-dti- Nh2 9606 Homo sapiens gi|288562785|pdb|2WRW|B 2WRW_B Chain B, Semi-Synthetic Highly Active Analogue Of Human Insulin D- Prob26-Dti-Nh2 9606 Homo sapiens gi|440690592|pdb|3W12|B 3W12_B Chain B, Insulin Receptor Ectodomain Construct Comprising Domains L1-cr In Complex With High-affinity Insulin Analogue [d-pro-b26]-dti-nh2, Alpha-ct Peptide(704-719) And Fab 83-7 9606 Homo sapiens gi|440690599|pdb|3W13|B 3W13_B Chain B, Insulin Receptor Ectodomain Construct Comprising Domains L1-cr In Complex With High-affinity Insulin Analogue [d-pro-b26]-dti-nh2, Alphact Peptide(693-719) And Fab 83-7 9606 Homo sapiens 26 1 54.299 129 6.6717e-08 25 25 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF FVNQHLCGSHLVEALYLVCGERGFF FVNQHLCGSHLVEALYLVCGERGFF 357 gi|1209978708|ref|XP_021382452.1| XP_021382452 insulin [Lonchura striata domestica] 299123 Lonchura striata domestica gi|1208030365|gb|OWK56814.1| OWK56814 Insulin [Lonchura striata domestica] 299123 Lonchura striata domestica 107 1 55.4546 132 6.67217e-08 25 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 358 gi|543356371|ref|XP_005522396.1| XP_005522396 PREDICTED: insulin [Pseudopodoces humilis] 181119 Pseudopodoces humilis gi|1341012853|ref|XP_023784614.1| XP_023784614 insulin [Cyanistes caeruleus] 156563 Cyanistes caeruleus gi|1341012855|ref|XP_023784615.1| XP_023784615 insulin [Cyanistes caeruleus] 156563 Cyanistes caeruleus 107 1 55.4546 132 6.67217e-08 25 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 359 gi|683896573|ref|XP_009100443.1| XP_009100443 PREDICTED: insulin [Serinus canaria] 9135 Serinus canaria gi|1095974111|ref|XP_018763605.1| XP_018763605 PREDICTED: insulin [Serinus canaria] 9135 Serinus canaria 107 1 55.4546 132 6.80977e-08 25 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 360 gi|284793774|pdb|2KQP|A 2KQP_A Chain A, NMR Structure of Proinsulin 9606 Homo sapiens 86 1 55.0694 131 7.08821e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGFFYTKPT FVNQHLCGS LVEALYLVCGERGFF T T 361 gnl|mdb|bmrb16608:1 bmrb16608:1 Proinsulin 86 1 55.0694 131 7.08821e-08 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGFFYTKPT FVNQHLCGS LVEALYLVCGERGFF T T 362 gi|54041125|sp|P67968.1|INS_MELGA P67968 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9103 Meleagris gallopavo gi|54041128|sp|P67969.1|INS_STRCA P67969 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8801 Struthio camelus gi|60392486|sp|P69047.1|INS_TRADO P69047 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 31137 Trachemys dorbigni gi|60392489|sp|P69048.1|INS_TRASC P69048 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 34903 Trachemys scripta gi|69326|pir||INTK INTK insulin - turkey (tentative sequence) [Meleagris gallopavo] 9103 Meleagris gallopavo gi|69327|pir||INOS INOS insulin - ostrich [Struthio camelus] 8801 Struthio camelus 51 1 54.299 129 7.42242e-08 24 25 23 51 2 30 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 363 gi|959078206|ref|XP_014742779.1| XP_014742779 PREDICTED: insulin [Sturnus vulgaris] 9172 Sturnus vulgaris 107 1 55.4546 132 7.46476e-08 25 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 364 gi|1072265323|ref|XP_018418167.1| XP_018418167 PREDICTED: insulin [Nanorana parkeri] 125878 Nanorana parkeri 106 1 55.4546 132 7.53104e-08 24 25 22 51 24 53 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT LANQHLCGSHLVEALYMVCGERGFFYYPKT NQHLCGSHLVEALY+VCGERGFF P T 365 gi|530652223|ref|XP_005312438.1| XP_005312438 insulin [Chrysemys picta bellii] 8478 Chrysemys picta bellii gi|1344914897|ref|XP_023957939.1| XP_023957939 insulin [Chrysemys picta bellii] 8478 Chrysemys picta bellii 107 1 55.4546 132 7.61862e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 366 gi|224050892|ref|XP_002198969.1| XP_002198969 PREDICTED: insulin [Taeniopygia guttata] 59729 Taeniopygia guttata 107 1 55.0694 131 7.77565e-08 25 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VNQHLCGSHLVEALYLVCGERGFFYQPKA VNQHLCGSHLVEALYLVCGERGFF P 367 gi|45382573|ref|NP_990553.1| NP_990553 insulin preproinsulin precursor [Gallus gallus] 9031 Gallus gallus gi|54037398|sp|P67970.1|INS_CHICK P67970 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 9031 Gallus gallus gi|853836|emb|CAA41738.1| CAA41738 preproinsulin [Gallus gallus] 9031 Gallus gallus gi|38176366|gb|AAR13049.1| AAR13049 preproinsulin [Gallus gallus] 9031 Gallus gallus gi|1337278752|gb|POI32815.1| POI32815 hypothetical protein CIB84_003433 [Bambusicola thoracicus] 9083 Bambusicola thoracica 107 1 55.0694 131 7.77565e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 368 gi|697481727|ref|XP_009672728.1| XP_009672728 PREDICTED: insulin [Struthio camelus australis] 441894 Struthio camelus australis gi|678214045|gb|KFV81024.1| KFV81024 Insulin [Struthio camelus australis] 441894 Struthio camelus australis 107 1 55.0694 131 7.85537e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 369 gi|326920126|ref|XP_003206326.1| XP_003206326 PREDICTED: insulin [Meleagris gallopavo] 9103 Meleagris gallopavo 107 1 55.0694 131 7.85537e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 370 gi|926528091|ref|XP_013813302.1| XP_013813302 PREDICTED: insulin [Apteryx australis mantelli] 202946 Apteryx australis mantelli 107 1 55.0694 131 7.9359e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 371 gi|657340876|sp|C0HJI8.1|INS2_HUSDA C0HJI8 RecName: Full=Insulin-2; Contains: RecName: Full=Insulin-2 B chain; Contains: RecName: Full=Insulin-2 A chain 55293 Huso dauricus 52 1 54.299 129 8.11743e-08 24 25 23 49 2 28 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGAHLVEALYLVCGERGFFYTP NQHLCG+HLVEALYLVCGERGFF TP 372 gi|512980271|ref|XP_004852149.1| XP_004852149 insulin [Heterocephalus glaber] 10181 Heterocephalus glaber gi|351712794|gb|EHB15713.1| EHB15713 Insulin [Heterocephalus glaber] 10181 Heterocephalus glaber 110 1 55.0694 131 8.12276e-08 24 26 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNRHLCGSHLVEALYLVCGDNGFFYTP FVN+HLCGSHLVEALYLVCG+ GFF TP 373 gi|558217065|ref|XP_006134976.1| XP_006134976 PREDICTED: insulin [Pelodiscus sinensis] 13735 Pelodiscus sinensis 106 1 55.0694 131 8.17186e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 374 gi|1586832|prf||2204398B 2204398B insulin:SUBUNIT=B chain 8456 Typhlonectes natans 30 1 53.9138 128 8.24034e-08 23 25 23 51 2 30 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCADRGFFYTPKS NQHLCGSHLVEALYLVC +RGFF TP + 375 gi|1215463999|gb|OXB63549.1| OXB63549 hypothetical protein ASZ78_008825 [Callipepla squamata] 9009 Callipepla squamata 107 1 55.0694 131 8.26632e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 376 gi|1201893508|ref|XP_021256643.1| XP_021256643 insulin [Numida meleagris] 8996 Numida meleagris gi|1201893510|ref|XP_021256644.1| XP_021256644 insulin [Numida meleagris] 8996 Numida meleagris gi|1215480774|gb|OXB74116.1| OXB74116 hypothetical protein H355_004453 [Colinus virginianus] 9014 Colinus virginianus 107 1 55.0694 131 8.35105e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 377 gi|1351524905|ref|XP_024064638.1| XP_024064638 insulin [Terrapene mexicana triunguis] 1415176 Terrapene mexicana triunguis 107 1 55.0694 131 8.5231e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 378 gi|1315514751|gb|PKU49206.1| PKU49206 tyrosine 3-monooxygenase [Limosa lapponica baueri] 1758121 Limosa lapponica baueri 596 1 58.151 139 8.89658e-08 24 25 24 49 516 541 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQHLCGSHLVEALYLVCGERGFFYSP NQHLCGSHLVEALYLVCGERGFF +P 379 gi|705698491|ref|XP_010124969.1| XP_010124969 PREDICTED: insulin [Chlamydotis macqueenii] 187382 Chlamydotis undulata macqueenii gi|677164501|gb|KFP44964.1| KFP44964 Insulin [Chlamydotis macqueenii] 187382 Chlamydotis undulata macqueenii 107 1 55.0694 131 8.96883e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 380 gi|998695260|ref|XP_015485235.1| XP_015485235 PREDICTED: insulin [Parus major] 9157 Parus major 137 1 55.4546 132 9.19766e-08 25 25 23 49 56 82 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP VNQHLCGSHLVEALYLVCGERGFFYQP VNQHLCGSHLVEALYLVCGERGFF P 381 gi|723572051|ref|XP_010305865.1| XP_010305865 PREDICTED: insulin [Balearica regulorum gibbericeps] 100784 Balearica pavonina gibbericeps gi|676249542|gb|KFO13414.1| KFO13414 Insulin [Balearica regulorum gibbericeps] 100784 Balearica pavonina gibbericeps 107 1 55.0694 131 9.34206e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 382 gi|1003779080|ref|XP_015719310.1| XP_015719310 PREDICTED: insulin [Coturnix japonica] 93934 Coturnix japonica gi|1003779084|ref|XP_015719311.1| XP_015719311 PREDICTED: insulin [Coturnix japonica] 93934 Coturnix japonica 107 1 55.0694 131 9.43776e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 383 gi|32891861|gb|AAP45968.1| AAP45968 preproinsulin, partial [Pica pica] 34924 Pica pica 55 1 54.299 129 9.46057e-08 24 25 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VSQHLCGSHLVEALYLVCGERGFFYQPKA V+QHLCGSHLVEALYLVCGERGFF P 384 gi|701362066|ref|XP_009985217.1| XP_009985217 PREDICTED: insulin [Tauraco erythrolophus] 121530 Tauraco erythrolophus gi|678149321|gb|KFV18472.1| KFV18472 Insulin [Tauraco erythrolophus] 121530 Tauraco erythrolophus 107 1 55.0694 131 9.53443e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 385 gi|159163013|pdb|1SJT|B 1SJT_B Chain B, Mini-Proinsulin, Two Chain Insulin Analog Mutant: Des B30, His(B 10)asp, Pro(B 28)asp, Nmr, 20 Structures 9606 Homo sapiens 29 1 53.9138 128 9.59444e-08 25 25 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSDLVEALYLVCGERGFFYTD FVNQHLCGS LVEALYLVCGERGFF T 386 gi|723129179|ref|XP_010280884.1| XP_010280884 PREDICTED: insulin [Phaethon lepturus] 97097 Phaethon lepturus gi|677482105|gb|KFQ71510.1| KFQ71510 Insulin [Phaethon lepturus] 97097 Phaethon lepturus 107 1 55.0694 131 9.63209e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 387 gi|327259963|ref|XP_003214805.1| XP_003214805 PREDICTED: insulin [Anolis carolinensis] 28377 Anolis carolinensis 107 1 55.0694 131 9.63209e-08 23 26 24 51 27 54 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQHLCGSHLVEALYLVCGDRGFYYSPKT NQHLCGSHLVEALYLVCG+RGF+ +P T 388 gi|690454885|ref|XP_009326802.1| XP_009326802 PREDICTED: insulin [Pygoscelis adeliae] 9238 Pygoscelis adeliae gi|679142587|gb|KFW70247.1| KFW70247 Insulin [Pygoscelis adeliae] 9238 Pygoscelis adeliae 107 1 55.0694 131 9.93109e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 389 gi|699615888|ref|XP_009875377.1| XP_009875377 PREDICTED: insulin [Apaloderma vittatum] 57397 Apaloderma vittatum gi|677310145|gb|KFP92573.1| KFP92573 Insulin [Apaloderma vittatum] 57397 Apaloderma vittatum 107 1 55.0694 131 9.93109e-08 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 390 gi|696964560|ref|XP_009570140.1| XP_009570140 PREDICTED: insulin [Cuculus canorus] 55661 Cuculus canorus gi|676581975|gb|KFO71884.1| KFO71884 Insulin [Cuculus canorus] 55661 Cuculus canorus 107 1 55.0694 131 1.01355e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 391 gi|700349525|ref|XP_009918866.1| XP_009918866 PREDICTED: insulin [Haliaeetus albicilla] 8969 Haliaeetus albicilla gi|729732603|ref|XP_010562197.1| XP_010562197 PREDICTED: insulin [Haliaeetus leucocephalus] 52644 Haliaeetus leucocephalus gi|768354297|ref|XP_011574118.1| XP_011574118 PREDICTED: insulin [Aquila chrysaetos canadensis] 216574 Aquila chrysaetos canadensis gi|677383327|gb|KFQ05338.1| KFQ05338 Insulin [Haliaeetus albicilla] 8969 Haliaeetus albicilla 107 1 55.0694 131 1.03442e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 392 gi|704294948|ref|XP_010160985.1| XP_010160985 PREDICTED: insulin isoform X1 [Antrostomus carolinensis] 279965 Caprimulgus carolinensis 109 1 55.0694 131 1.03616e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 393 gi|675318581|gb|KFM13843.1| KFM13843 Insulin [Aptenodytes forsteri] 9233 Aptenodytes forsteri 107 1 55.0694 131 1.05571e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 394 gi|971397361|ref|XP_015142065.1| XP_015142065 insulin isoform X1 [Gallus gallus] 9031 Gallus gallus 132 1 55.0694 131 1.05576e-07 24 25 23 49 51 77 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGERGFFYSP NQHLCGSHLVEALYLVCGERGFF +P 395 gi|695156081|ref|XP_009505989.1| XP_009505989 PREDICTED: insulin [Phalacrocorax carbo] 9209 Phalacrocorax carbo gi|679210378|gb|KFW92636.1| KFW92636 Insulin [Phalacrocorax carbo] 9209 Phalacrocorax carbo 107 1 55.0694 131 1.06652e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 396 gi|719760052|ref|XP_010216040.1| XP_010216040 PREDICTED: insulin [Tinamus guttatus] 94827 Tinamus guttatus gi|697418381|gb|KGL79406.1| KGL79406 Insulin [Tinamus guttatus] 94827 Tinamus guttatus 107 1 54.6842 130 1.07744e-07 24 25 24 51 27 54 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 397 gi|697016339|ref|XP_009585695.1| XP_009585695 PREDICTED: insulin [Fulmarus glacialis] 30455 Fulmarus glacialis gi|678992481|gb|KFV98784.1| KFV98784 Insulin [Fulmarus glacialis] 30455 Fulmarus glacialis 107 1 54.6842 130 1.07744e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 398 gi|697830423|ref|XP_009635579.1| XP_009635579 PREDICTED: insulin [Egretta garzetta] 188379 Egretta garzetta gi|676819738|gb|KFP14696.1| KFP14696 Insulin [Egretta garzetta] 188379 Egretta garzetta 107 1 54.6842 130 1.08847e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 399 gi|698451077|ref|XP_009700848.1| XP_009700848 PREDICTED: insulin [Cariama cristata] 54380 Cariama cristata gi|677274908|gb|KFP66226.1| KFP66226 Insulin [Cariama cristata] 54380 Cariama cristata 107 1 54.6842 130 1.11087e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 400 gi|699696854|ref|XP_009890293.1| XP_009890293 PREDICTED: insulin [Charadrius vociferus] 50402 Charadrius vociferus gi|697465472|gb|KGL98857.1| KGL98857 Insulin [Charadrius vociferus] 50402 Charadrius vociferus 107 1 54.6842 130 1.12224e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 401 gi|700426205|ref|XP_009951612.1| XP_009951612 PREDICTED: insulin [Leptosomus discolor] 188344 Leptosomus discolor gi|677373868|gb|KFP99382.1| KFP99382 Insulin [Leptosomus discolor] 188344 Leptosomus discolor 107 1 54.6842 130 1.15705e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 402 gi|704237624|ref|XP_010159413.1| XP_010159413 PREDICTED: insulin [Eurypyga helias] 54383 Eurypyga helias gi|678993532|gb|KFV99407.1| KFV99407 Insulin [Eurypyga helias] 54383 Eurypyga helias 107 1 54.6842 130 1.16889e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 403 gi|704542296|ref|XP_010177077.1| XP_010177077 PREDICTED: insulin [Mesitornis unicolor] 54374 Mesitornis unicolor gi|677429256|gb|KFQ30226.1| KFQ30226 Insulin [Mesitornis unicolor] 54374 Mesitornis unicolor 107 1 54.6842 130 1.18085e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 404 gi|701348815|ref|XP_009974501.1| XP_009974501 PREDICTED: insulin [Tyto alba] 56313 Tyto alba gi|678176558|gb|KFV44514.1| KFV44514 Insulin [Tyto alba] 56313 Tyto alba 107 1 54.6842 130 1.22993e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 405 gi|677229271|gb|KFP52374.1| KFP52374 Insulin [Cathartes aura] 43455 Cathartes aura 107 1 54.6842 130 1.28105e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 406 gi|13517221|gb|AAK28710.1| AAK28710 preproinsulin, partial [Chitala chitala] 112163 Chitala chitala 111 1 54.6842 130 1.29662e-07 24 24 24 49 26 51 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQHLCGSHLVEALYLVCGERGFFYNP NQHLCGSHLVEALYLVCGERGFF P 407 gi|159163036|pdb|1T1K|B 1T1K_B Chain B, NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-ALA, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES 30 1 53.5286 127 1.29878e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLAEALYLVCGERGFFYTKPT FVNQHLCGS L EALYLVCGERGFF T T 408 gi|701302509|ref|XP_010011817.1| XP_010011817 PREDICTED: insulin [Nestor notabilis] 176057 Nestor notabilis gi|677459164|gb|KFQ48578.1| KFQ48578 Insulin [Nestor notabilis] 176057 Nestor notabilis 107 1 54.6842 130 1.30739e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 409 gi|148229753|ref|NP_001079351.1| NP_001079351 insulin-1 precursor [Xenopus laevis] 8355 Xenopus laevis gi|124513|sp|P12706.2|INS1_XENLA P12706 RecName: Full=Insulin-1; Contains: RecName: Full=Insulin-1 B chain; Contains: RecName: Full=Insulin-1 A chain; Flags: Precursor 8355 Xenopus laevis gi|214537|gb|AAA49888.1| AAA49888 preproinsulin I [Xenopus laevis] 8355 Xenopus laevis gi|1050379651|gb|OCT81847.1| OCT81847 hypothetical protein XELAEV_18024354mg [Xenopus laevis] 8355 Xenopus laevis 106 1 54.6842 130 1.31958e-07 24 25 22 49 24 51 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP LVNQHLCGSHLVEALYLVCGDRGFFYYP VNQHLCGSHLVEALYLVCG+RGFF P 410 gi|704294952|ref|XP_010160986.1| XP_010160986 PREDICTED: insulin isoform X2 [Antrostomus carolinensis] 279965 Caprimulgus carolinensis gi|683458255|gb|KFZ53429.1| KFZ53429 Insulin [Antrostomus carolinensis] 279965 Caprimulgus carolinensis 107 1 54.6842 130 1.32076e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYSPKA NQHLCGSHLVEALYLVCGERGFF +P 411 gi|1111013672|ref|XP_009287016.2| XP_009287016 PREDICTED: insulin [Aptenodytes forsteri] 9233 Aptenodytes forsteri 120 1 54.6842 130 1.36899e-07 24 25 23 49 39 65 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGERGFFYSP NQHLCGSHLVEALYLVCGERGFF +P 412 gi|168988637|pdb|2JZQ|A 2JZQ_A Chain A, Design of an Active Ultra-Stable Single-Chain Insulin Analog 20 Structures gi|534436342|pdb|2LWZ|A 2LWZ_A Chain A, NMR Structures of Single-chain Insulin 9606 Homo sapiens 57 1 53.9138 128 1.38181e-07 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGFFYTDPT FVNQHLCGS LVEALYLVCGERGFF T T 413 gnl|mdb|bmrb18654:1 bmrb18654:1 Single-chain Insulin 57 1 53.9138 128 1.38181e-07 26 26 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGFFYTDPT FVNQHLCGS LVEALYLVCGERGFF T T 414 gi|159163038|pdb|1T1P|B 1T1P_B Chain B, NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-THR, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES 30 1 53.1434 126 1.50603e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLTEALYLVCGERGFFYTKPT FVNQHLCGS L EALYLVCGERGFF T T 415 gi|683459485|gb|KFZ54411.1| KFZ54411 Insulin, partial [Podiceps cristatus] 345573 Podiceps cristatus 62 1 53.9138 128 1.51356e-07 23 24 23 49 26 52 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ATQHLCGSHLVEALYLVCGERGFFYSP QHLCGSHLVEALYLVCGERGFF +P 416 gi|602711552|ref|XP_007466015.1| XP_007466015 PREDICTED: insulin [Lipotes vexillifer] 118797 Lipotes vexillifer 110 1 54.299 129 1.55613e-07 24 25 22 46 25 49 25 0 FVNQHLCGSHLVEALYLVCGERGFF FVSQHLCGSHLVEALYLVCGERGFF FV+QHLCGSHLVEALYLVCGERGFF 417 gi|159163014|pdb|1SJU|A 1SJU_A Chain A, MINI-PROINSULIN, SINGLE CHAIN INSULIN ANALOG MUTANT: DES B30, HIS(B 10)ASP, PRO(B 28)ASP AND PEPTIDE BOND BETWEEN LYS B 29 AND GLY A 1, NMR, 20 STRUCTURES 9606 Homo sapiens 50 1 53.5286 127 1.55955e-07 25 25 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSDLVEALYLVCGERGFFYTD FVNQHLCGS LVEALYLVCGERGFF T 418 gi|154147722|ref|NP_001093706.1| NP_001093706 insulin precursor [Xenopus tropicalis] 8364 Xenopus (Silurana) tropicalis gi|134254262|gb|AAI35266.1| AAI35266 ins protein [Xenopus tropicalis] 8364 Xenopus (Silurana) tropicalis gi|1270539771|gb|ATO97293.1| ATO97293 insulin, partial [synthetic construct] 32630 synthetic construct 106 1 54.299 129 1.68476e-07 25 27 13 49 15 51 37 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP LFSTPNTEALANQHLCGSHLVEALYLVCGDRGFFYYP L+ N NQHLCGSHLVEALYLVCG+RGFF P 419 gi|557015358|ref|XP_006008147.1| XP_006008147 PREDICTED: insulin [Latimeria chalumnae] 7897 Latimeria chalumnae 107 1 54.299 129 1.77382e-07 23 25 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP IANQHLCGSHLVEALYLVCGEKGFFYSP NQHLCGSHLVEALYLVCGE+GFF +P 420 gi|1197603934|ref|XP_005499300.2| XP_005499300 insulin isoform X1 [Columba livia] 8932 Columba livia 139 1 54.299 129 1.95525e-07 23 25 23 49 58 84 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGDRGFFYSP NQHLCGSHLVEALYLVCG+RGFF +P 421 gi|147899605|ref|NP_001079350.1| NP_001079350 insulin-2 precursor [Xenopus laevis] 8355 Xenopus laevis gi|124526|sp|P12707.2|INS2_XENLA P12707 RecName: Full=Insulin-2; Contains: RecName: Full=Insulin-2 B chain; Contains: RecName: Full=Insulin-2 A chain; Flags: Precursor 8355 Xenopus laevis gi|214535|gb|AAA49887.1| AAA49887 preproinsulin II [Xenopus laevis] 8355 Xenopus laevis gi|213626809|gb|AAI70154.1| AAI70154 Insulin-like growth factor 2 (somatomedin A) [Xenopus laevis] 8355 Xenopus laevis gi|213627675|gb|AAI69878.1| AAI69878 Insulin-like growth factor 2 (somatomedin A) [Xenopus laevis] 8355 Xenopus laevis gi|1050381678|gb|OCT83873.1| OCT83873 hypothetical protein XELAEV_18022012mg [Xenopus laevis] 8355 Xenopus laevis 106 1 53.9138 128 2.04387e-07 25 27 13 49 15 51 37 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP LFSTPNTEALANQHLCGSHLVEALYLVCGDRGFFYYP L+ N NQHLCGSHLVEALYLVCG+RGFF P 422 gi|32891841|gb|AAP45958.1| AAP45958 preproinsulin, partial [Falco tinnunculus] 100819 Falco tinnunculus gi|32891851|gb|AAP45963.1| AAP45963 preproinsulin, partial [Melopsittacus undulatus] 13146 Melopsittacus undulatus 55 1 53.1434 126 2.10208e-07 23 24 23 49 19 45 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ATQHLCGSHLVEALYLVCGERGFFYSP QHLCGSHLVEALYLVCGERGFF +P 423 gi|1197603936|ref|XP_021155312.1| XP_021155312 insulin isoform X2 [Columba livia] 8932 Columba livia gi|1197603938|ref|XP_021155316.1| XP_021155316 insulin isoform X2 [Columba livia] 8932 Columba livia gi|1307745663|gb|PKK29191.1| PKK29191 insulin [Columba livia] 8932 Columba livia 107 1 53.9138 128 2.19559e-07 23 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGDRGFFYSPKA NQHLCGSHLVEALYLVCG+RGFF +P 424 gi|1159642818|gb|OPJ73783.1| OPJ73783 insulin [Patagioenas fasciata monilis] 372326 Patagioenas fasciata monilis 116 1 54.299 129 2.23178e-07 23 25 23 51 35 63 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGDRGFFYSPKA NQHLCGSHLVEALYLVCG+RGFF +P 425 gi|927028762|dbj|BAS32718.1| BAS32718 insulin, partial [Scincus scincus] 155317 Scincus scincus 97 1 53.9138 128 2.23613e-07 23 26 22 51 16 45 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FPSQHLCGSHLVEALYLVCGERGFYYSPKA F +QHLCGSHLVEALYLVCGERGF+ +P 426 gi|159163040|pdb|1T1Q|B 1T1Q_B Chain B, NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-ABA, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES 30 1 52.7582 125 2.25044e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLXEALYLVCGERGFFYTKPT FVNQHLCGS L EALYLVCGERGFF T T 427 gi|159164631|pdb|2HHO|B 2HHO_B Chain B, NMR structure of human insulin mutant GLY-B8-SER, HIS-B10-ASP PRO-B28-LYS, LYS-B29-PRO, 20 structures 9606 Homo sapiens 30 1 52.7582 125 2.32291e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCSSDLVEALYLVCGERGFFYTKPT FVNQHLC S LVEALYLVCGERGFF T T 428 gi|1881821|gb|AAB49513.1| AAB49513 insulin B chain [Ornithorhynchus anatinus=platypuses, pancreas, Peptide, 30 aa] 9258 Ornithorhynchus anatinus gi|1589402|prf||2211251B 2211251B insulin:SUBUNIT=B chain 9258 Ornithorhynchus anatinus 30 1 52.7582 125 2.34758e-07 23 25 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPNQHLCGSHLVEALYLVCGEKGFYYIP F NQHLCGSHLVEALYLVCGE+GF+ P 429 gi|159162032|pdb|1A7F|B 1A7F_B Chain B, Insulin Mutant B16 Glu, B24 Gly, Des-B30, Nmr, 20 Structures 9606 Homo sapiens 29 1 52.7582 125 2.4076e-07 25 25 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNQHLCGSHLVEALELVCGERGGFYTP FVNQHLCGSHLVEAL LVCGERG F TP 430 gi|32891845|gb|AAP45960.1| AAP45960 preproinsulin, partial [Gallinula chloropus] 9123 Gallinula chloropus 55 1 53.1434 126 2.62023e-07 23 24 23 49 19 45 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ATQHLCGSHLVEALYLVCGERGFFYSP QHLCGSHLVEALYLVCGERGFF +P 431 gi|669265958|ref|XP_008642491.1| XP_008642491 PREDICTED: insulin [Corvus brachyrhynchos] 85066 Corvus brachyrhynchos gi|676410449|gb|KFO54645.1| KFO54645 Insulin [Corvus brachyrhynchos] 85066 Corvus brachyrhynchos 104 1 53.5286 127 2.91352e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VSQHLCGSHLVEALYLVCGERGFFYQPKA V+QHLCGSHLVEALYLVCGERGFF P 432 gi|972976386|ref|XP_006631777.2| XP_006631777 PREDICTED: insulin-like isoform X2 [Lepisosteus oculatus] 7918 Lepisosteus oculatus 129 1 53.9138 128 2.97545e-07 23 24 23 49 43 69 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGEKGFFYNP NQHLCGSHLVEALYLVCGE+GFF P 433 gi|32891863|gb|AAP45969.1| AAP45969 preproinsulin, partial [Rhea americana] 8797 Rhea americana 55 1 52.7582 125 3.13159e-07 23 24 23 51 19 47 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCRERGFFYSPKA NQHLCGSHLVEALYLVC ERGFF +P 434 gi|524998196|ref|XP_005046861.1| XP_005046861 PREDICTED: insulin [Ficedula albicollis] 59894 Ficedula albicollis 107 1 53.5286 127 3.16343e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VSQHLCGSHLVEALYLVCGERGFFYQPKA V+QHLCGSHLVEALYLVCGERGFF P 435 gi|602634847|ref|XP_007424294.1| XP_007424294 insulin [Python bivittatus] 176946 Python bivittatus 104 1 53.5286 127 3.29142e-07 22 26 24 51 27 54 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQHLCGSHLVEALYLVCGDRGFYYSPRS NQHLCGSHLVEALYLVCG+RGF+ +P + 436 gi|726986319|ref|XP_010395059.1| XP_010395059 insulin [Corvus cornix cornix] 932674 Corvus cornix cornix 107 1 53.5286 127 3.32786e-07 24 25 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VSQHLCGSHLVEALYLVCGERGFFYQPKA V+QHLCGSHLVEALYLVCGERGFF P 437 gi|298508259|pdb|2KJU|B 2KJU_B Chain B, NMR structure of human insulin mutant glu-b21-d-glu, his-b10 asp pro-b28-lys, lys-b29-pro, 20 structures 9606 Homo sapiens 30 1 52.373 124 3.36177e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGXRGFFYTKPT FVNQHLCGS LVEALYLVCG RGFF T T 438 gi|32171962|sp|P01328.1|INS_HYSCR P01328 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 10137 Hystrix cristata 51 1 52.7582 125 3.48289e-07 24 24 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCGNDGFFYRPKA FVNQHLCGSHLVEALYLVCG GFF P 439 gi|972976388|ref|XP_015204784.1| XP_015204784 PREDICTED: insulin-like isoform X3 [Lepisosteus oculatus] 7918 Lepisosteus oculatus 112 1 53.5286 127 3.71036e-07 23 24 23 49 26 52 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGEKGFFYNP NQHLCGSHLVEALYLVCGE+GFF P 440 gi|972976382|ref|XP_015204782.1| XP_015204782 PREDICTED: insulin-like isoform X1 [Lepisosteus oculatus] 7918 Lepisosteus oculatus gi|972976384|ref|XP_015204783.1| XP_015204783 PREDICTED: insulin-like isoform X1 [Lepisosteus oculatus] 7918 Lepisosteus oculatus 133 1 53.5286 127 3.90221e-07 23 24 23 49 47 73 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGEKGFFYNP NQHLCGSHLVEALYLVCGE+GFF P 441 gi|32172034|sp|Q9TQY7.2|INS_ORNAN Q9TQY7 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 9258 Ornithorhynchus anatinus 51 1 52.373 124 3.9504e-07 23 25 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPNQHLCGSHLVEALYLVCGEKGFYYIP F NQHLCGSHLVEALYLVCGE+GF+ P 442 gi|345110695|pdb|2L1Y|B 2L1Y_B Chain B, NMR Structure of human insulin mutant GLY-B20-D-ALA, GLY-B23-D-ALA PRO-B28-LYS, LYS-B29-PRO, 20 Structures 9606 Homo sapiens gi|385867323|pdb|3ROV|B 3ROV_B Chain B, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867325|pdb|3ROV|D 3ROV_D Chain D, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867327|pdb|3ROV|F 3ROV_F Chain F, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867329|pdb|3ROV|H 3ROV_H Chain H, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867331|pdb|3ROV|J 3ROV_J Chain J, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867333|pdb|3ROV|L 3ROV_L Chain L, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus 30 1 51.9878 123 4.02254e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSHLVEALYLVCXERXFFYTKPT FVNQHLCGSHLVEALYLVC ER FF T T 443 gi|673541189|pdb|2MLI|B 2MLI_B Chain B, NMR structure of B25-(alpha, beta)-dehydro-phenylalanine insulin 30 1 51.9878 123 4.15193e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGFXYTKPT FVNQHLCGS LVEALYLVCGERGF T T 444 gi|212374855|pdb|2K9R|B 2K9R_B Chain B, Enhancing the activity of insulin by stereospecific unfolding 9606 Homo sapiens 30 1 51.9878 123 4.15193e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGXFYTKPT FVNQHLCGS LVEALYLVCGERG F T T 445 gi|679188623|gb|KFW79394.1| KFW79394 Insulin [Manacus vitellinus] 328815 Manacus vitellinus 107 1 53.1434 126 4.15846e-07 24 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYYPKA NQHLCGSHLVEALYLVCGERGFF P 446 gi|1051115592|ref|XP_017662937.1| XP_017662937 PREDICTED: insulin isoform X2 [Lepidothrix coronata] 321398 Lepidothrix coronata 134 1 53.5286 127 4.20409e-07 24 24 23 51 53 81 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYYPKA NQHLCGSHLVEALYLVCGERGFF P 447 gi|112491347|pdb|2HH4|B 2HH4_B Chain B, NMR structure of human insulin mutant GLY-B8-D-SER, HIS-B10-ASP PRO-B28-LYS, LYS-B29-PRO, 20 structures 9606 Homo sapiens gi|312597013|pdb|2KQQ|B 2KQQ_B Chain B, NMR structure of human insulin mutant gly-b8-d-ala, his-b10-asp, pro-b28-lys, lys-b29-pro, 20 structures 9606 Homo sapiens 30 1 51.9878 123 4.28547e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCXSDLVEALYLVCGERGFFYTKPT FVNQHLC S LVEALYLVCGERGFF T T 448 gi|32171989|sp|P09476.1|INS_ATRSP P09476 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7917 Atractosteus spatula 52 1 52.373 124 4.31631e-07 23 24 23 49 2 28 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGEKGFFYNP NQHLCGSHLVEALYLVCGE+GFF P 449 gi|9408409|gb|AAF87285.1|AF227187_1 AAF87285 preproinsulin [Rana pipiens] 8404 Rana pipiens 106 1 53.1434 126 4.41945e-07 22 27 22 51 24 53 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FDNQYLCGSHLVEALYMVCGDRGFFYSPRS F NQ+LCGSHLVEALY+VCG+RGFF +P + 450 gi|1062825449|ref|XP_008920278.2| XP_008920278 PREDICTED: insulin isoform X2 [Manacus vitellinus] 328815 Manacus vitellinus 131 1 53.5286 127 4.43393e-07 24 24 23 51 50 78 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ANQHLCGSHLVEALYLVCGERGFFYYPKA NQHLCGSHLVEALYLVCGERGFF P 451 gi|159164619|pdb|2H67|B 2H67_B Chain B, NMR structure of human insulin mutant HIS-B5-ALA, HIS-B10-ASP PRO-B28-LYS, LYS-B29-PRO, 20 structures 9606 Homo sapiens 30 1 51.9878 123 4.47023e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQALCGSDLVEALYLVCGERGFFYTKPT FVNQ LCGS LVEALYLVCGERGFF T T 452 gi|213424022|pdb|2K91|B 2K91_B Chain B, Enhancing the activity of insulin by stereospecific unfolding 9606 Homo sapiens 30 1 51.9878 123 4.56556e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGAFYTKPT FVNQHLCGS LVEALYLVCGERG F T T 453 gi|1051115588|ref|XP_017662921.1| XP_017662921 PREDICTED: insulin isoform X1 [Lepidothrix coronata] 321398 Lepidothrix coronata gi|1051115590|ref|XP_017662927.1| XP_017662927 PREDICTED: insulin isoform X1 [Lepidothrix coronata] 321398 Lepidothrix coronata 159 1 53.5286 127 4.69282e-07 24 24 23 49 78 104 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGERGFFYYP NQHLCGSHLVEALYLVCGERGFF P 454 gi|1276619892|gb|PIO38763.1| PIO38763 hypothetical protein AB205_0035720 [Rana catesbeiana] 8400 Rana catesbeiana 123 1 53.1434 126 4.75459e-07 22 27 22 51 42 71 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FPNQYLCGSHLVEALYMVCGDRGFFYSPRS F NQ+LCGSHLVEALY+VCG+RGFF +P + 455 gi|1062825440|ref|XP_017931499.1| XP_017931499 PREDICTED: insulin isoform X1 [Manacus vitellinus] 328815 Manacus vitellinus gi|1062825444|ref|XP_017931500.1| XP_017931500 PREDICTED: insulin isoform X1 [Manacus vitellinus] 328815 Manacus vitellinus 159 1 53.5286 127 4.78579e-07 24 24 23 49 78 104 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLVEALYLVCGERGFFYYP NQHLCGSHLVEALYLVCGERGFF P 456 gi|1246088|gb|AAB35904.1| AAB35904 insulin B-chain [Amphiuma tridactylum=three-toed amphiuma, pancreatic extract, Peptide, 29 aa] 8313 Amphiuma tridactylum 29 1 51.6026 122 5.662e-07 22 25 24 49 3 28 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQYLCGSHLVEALYLVCGDRGFFYSP NQ+LCGSHLVEALYLVCG+RGFF +P 457 gi|116235019|dbj|BAF34949.1| BAF34949 insulin, partial [Oryzias latipes] 8090 Oryzias latipes 109 1 52.7582 125 5.91677e-07 23 24 25 49 23 47 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVEALYLVCGDRGFFYTP QHLCGSHLVEALYLVCG+RGFF TP 458 gi|529435196|ref|XP_005237374.1| XP_005237374 PREDICTED: insulin [Falco peregrinus] 8954 Falco peregrinus gi|541970582|ref|XP_005439170.1| XP_005439170 PREDICTED: insulin [Falco cherrug] 345164 Falco cherrug 107 1 52.7582 125 6.04567e-07 23 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATQHLCGSHLVEALYLVCGERGFFYSPKA QHLCGSHLVEALYLVCGERGFF +P 459 gi|694641148|ref|XP_009478657.1| XP_009478657 PREDICTED: insulin [Pelecanus crispus] 36300 Pelecanus crispus 107 1 52.7582 125 6.295e-07 23 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATQHLCGSHLVEALYLVCGERGFFYSPKA QHLCGSHLVEALYLVCGERGFF +P 460 gi|394556800|dbj|BAM29044.1| BAM29044 insulin, partial [Suncus murinus] 9378 Suncus murinus 77 1 52.373 124 6.5844e-07 23 24 25 51 1 27 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QHLCGAHLVEALYLVCGERGFFYTPKA QHLCG+HLVEALYLVCGERGFF TP 461 gi|698400120|ref|XP_009808574.1| XP_009808574 PREDICTED: insulin [Gavia stellata] 37040 Gavia stellata gi|678184625|gb|KFV52347.1| KFV52347 Insulin [Gavia stellata] 37040 Gavia stellata 107 1 52.7582 125 6.68829e-07 23 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATQHLCGSHLVEALYLVCGERGFFYSPKA QHLCGSHLVEALYLVCGERGFF +P 462 gi|694830771|ref|XP_009460806.1| XP_009460806 PREDICTED: insulin [Nipponia nippon] 128390 Nipponia nippon gi|677497642|gb|KFQ87047.1| KFQ87047 Insulin [Phoenicopterus ruber ruber] 9218 Phoenicopterus ruber ruber gi|677527739|gb|KFQ91000.1| KFQ91000 Insulin [Nipponia nippon] 128390 Nipponia nippon 107 1 52.7582 125 7.39885e-07 23 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATQHLCGSHLVEALYLVCGERGFFYSPKA QHLCGSHLVEALYLVCGERGFF +P 463 gi|9973534|sp|Q9W7R2.1|INS_VERMO Q9W7R2 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 98923 Verasper moseri gi|5381267|dbj|BAA82315.1| BAA82315 preproinsulin [Verasper moseri] 98923 Verasper moseri 115 1 52.7582 125 7.84748e-07 22 24 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGAHLVDALYLVCGERGFFYTP QHLCG+HLV+ALYLVCGERGFF TP 464 gi|944216491|gb|KQK82428.1| KQK82428 insulin [Amazona aestiva] 12930 Amazona aestiva 107 1 52.373 124 7.86074e-07 23 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATQHLCGSHLVEALYLVCGERGFFYSPKA QHLCGSHLVEALYLVCGERGFF +P 465 gi|675610563|ref|XP_008933914.1| XP_008933914 PREDICTED: insulin [Merops nubicus] 57421 Merops nubicus gi|677421866|gb|KFQ25486.1| KFQ25486 Insulin [Merops nubicus] 57421 Merops nubicus 107 1 52.373 124 7.86074e-07 24 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VTQHLCGSHLVEALYLVCGERGFFYYPKA V QHLCGSHLVEALYLVCGERGFF P 466 gi|1189432040|pdb|2MPI|B 2MPI_B Chain B, Solution structure of B24G insulin 9606 Homo sapiens 30 1 51.2174 121 7.90021e-07 25 25 22 51 1 30 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FVNQHLCGSDLVEALYLVCGERGGFYTKPT FVNQHLCGS LVEALYLVCGERG F T T 467 gi|704467453|ref|XP_010086003.1| XP_010086003 PREDICTED: insulin [Pterocles gutturalis] 240206 Pterocles gutturalis gi|678136347|gb|KFV05519.1| KFV05519 Insulin [Pterocles gutturalis] 240206 Pterocles gutturalis 107 1 52.373 124 7.94046e-07 23 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATQHLCGSHLVEALYLVCGERGFFYSPKA QHLCGSHLVEALYLVCGERGFF +P 468 gi|13517223|gb|AAK28711.1| AAK28711 preproinsulin, partial [Gnathonemus petersii] 42645 Gnathonemus petersii 87 1 52.373 124 8.02846e-07 23 24 25 51 4 30 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QHLCGSHLVEALFLVCGERGFFFNPDT QHLCGSHLVEAL+LVCGERGFF P T 469 gi|225446|prf||1303322A 1303322A insulin 8018 Oncorhynchus keta 94 1 52.373 124 8.57123e-07 22 24 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYTP QHLCGSHLV+ALYLVCGE+GFF TP 470 gi|706126093|ref|XP_010198080.1| XP_010198080 PREDICTED: insulin [Colius striatus] 57412 Colius striatus gi|677091078|gb|KFP30862.1| KFP30862 Insulin [Colius striatus] 57412 Colius striatus 107 1 52.373 124 8.87231e-07 23 24 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QHLCGSHLVEALYLVCGERGFFYSPKA QHLCGSHLVEALYLVCGERGFF +P 471 gi|527262035|ref|XP_005149257.1| XP_005149257 PREDICTED: insulin [Melopsittacus undulatus] 13146 Melopsittacus undulatus 107 1 52.373 124 9.05307e-07 23 24 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATQHLCGSHLVEALYLVCGERGFFYSPKA QHLCGSHLVEALYLVCGERGFF +P 472 gi|410914128|ref|XP_003970540.1| XP_003970540 PREDICTED: insulin-like [Takifugu rubripes] 31033 Takifugu rubripes 110 1 52.373 124 9.58317e-07 22 24 22 49 23 50 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPAQHLCGSHLVDALYIVCGERGFFADP F QHLCGSHLV+ALY+VCGERGFF P 473 gi|765163312|ref|XP_004084370.2| XP_004084370 insulin [Oryzias latipes] 8090 Oryzias latipes 187 1 52.7582 125 9.71886e-07 23 24 25 49 100 124 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVEALYLVCGDRGFFYTP QHLCGSHLVEALYLVCG+RGFF TP 474 gi|1143420651|ref|XP_019964407.1| XP_019964407 PREDICTED: insulin [Paralichthys olivaceus] 8255 Paralichthys olivaceus gi|1143420653|ref|XP_019964408.1| XP_019964408 PREDICTED: insulin [Paralichthys olivaceus] 8255 Paralichthys olivaceus 116 1 52.373 124 1.02571e-06 22 24 25 49 30 54 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGAHLVDALYLVCGERGFFYTP QHLCG+HLV+ALYLVCGERGFF TP 475 gi|213445|gb|AAA49414.1| AAA49414 preproinsulin [Oncorhynchus keta] 8018 Oncorhynchus keta gi|223664|prf||0906264A 0906264A insulin,prepro 8018 Oncorhynchus keta 105 1 51.9878 123 1.20269e-06 22 24 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYTP QHLCGSHLV+ALYLVCGE+GFF TP 476 gi|124657|sp|P04667.2|INS_ONCKE P04667 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 8018 Oncorhynchus keta gi|295725|emb|CAA31910.1| CAA31910 preproinsulin [Oncorhynchus keta] 8018 Oncorhynchus keta 105 1 51.9878 123 1.20269e-06 22 24 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYTP QHLCGSHLV+ALYLVCGE+GFF TP 477 gi|677978618|ref|XP_009073003.1| XP_009073003 PREDICTED: insulin [Acanthisitta chloris] 57068 Acanthisitta chloris gi|677297753|gb|KFP80181.1| KFP80181 Insulin [Acanthisitta chloris] 57068 Acanthisitta chloris 106 1 51.6026 122 1.44056e-06 23 23 23 46 26 49 24 0 VNQHLCGSHLVEALYLVCGERGFF ANQHLCGSHLVEALYLVCGERGFF NQHLCGSHLVEALYLVCGERGFF 478 gi|557321174|ref|XP_006033708.1| XP_006033708 PREDICTED: insulin [Alligator sinensis] 38654 Alligator sinensis gi|1113795410|ref|XP_019332234.1| XP_019332234 PREDICTED: insulin [Alligator mississippiensis] 8496 Alligator mississippiensis 107 1 51.6026 122 1.60714e-06 22 24 23 49 26 52 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQRLCGSHLVDALYLVCGERGFFYSP NQ LCGSHLV+ALYLVCGERGFF +P 479 gi|1942327|pdb|1SDB|B 1SDB_B Chain B, Porcine Desb1-2 Despentapeptide(B26-B30) Insulin 9823 Sus scrofa 23 1 50.447 119 1.61892e-06 23 23 24 46 1 23 23 0 NQHLCGSHLVEALYLVCGERGFF NQHLCGSHLVEALYLVCGERGFF NQHLCGSHLVEALYLVCGERGFF 480 gi|60672444|gb|AAX33328.1| AAX33328 insulin, partial [Lagidium viscacia] 84623 Lagidium viscacia 51 1 50.8322 120 1.67662e-06 21 25 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP IVNKHLCGSHLVEALYMVCRDKGFFYTP VN+HLCGSHLVEALY+VC ++GFF TP 481 gi|1387729504|gb|PWA23681.1| PWA23681 hypothetical protein CCH79_00005979 [Gambusia affinis] 33528 Gambusia affinis 225 1 52.7582 125 1.71302e-06 20 23 24 49 119 144 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQHLCGSHLVDALYFICGERGFYYGP NQHLCGSHLV+ALY +CGERGF+ P 482 gi|32171992|sp|P09477.1|INS_PLAFE P09477 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8260 Platichthys flesus 51 1 50.8322 120 1.76658e-06 22 24 25 49 5 29 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGAHLVDALYLVCGERGFFYTP QHLCG+HLV+ALYLVCGERGFF TP 483 gi|14161273|gb|AAK54684.1| AAK54684 preproinsulin, partial [Hiodon alosoides] 54904 Hiodon alosoides 110 1 51.6026 122 1.8217e-06 21 25 24 51 26 53 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SQHLCGSHLVDALYMVCGEKGFFYQPKT +QHLCGSHLV+ALY+VCGE+GFF P T 484 gi|60672454|gb|AAX33333.1| AAX33333 insulin, partial [Dolichotis patagonum] 29091 Dolichotis patagonum 51 1 50.8322 120 1.82286e-06 21 24 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNRHLCGSHLVDALYSACGDRGFFYIP FVN+HLCGSHLV+ALY CG+RGFF P 485 gi|1121907793|ref|XP_019406793.1| XP_019406793 PREDICTED: insulin [Crocodylus porosus] 8502 Crocodylus porosus 107 1 51.6026 122 1.83147e-06 22 24 23 49 26 52 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQRLCGSHLVDALYLVCGERGFFYSP NQ LCGSHLV+ALYLVCGERGFF +P 486 gi|32171998|sp|P12703.2|INS_ALLMI P12703 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8496 Alligator mississippiensis 51 1 50.8322 120 1.84201e-06 22 24 23 49 2 28 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQRLCGSHLVDALYLVCGERGFFYSP NQ LCGSHLV+ALYLVCGERGFF +P 487 gi|1117362832|ref|XP_019375557.1| XP_019375557 PREDICTED: insulin [Gavialis gangeticus] 94835 Gavialis gangeticus 107 1 51.6026 122 1.92581e-06 22 24 23 49 26 52 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQRLCGSHLVDALYLVCGERGFFYSP NQ LCGSHLV+ALYLVCGERGFF +P 488 gi|927028772|dbj|BAS32723.1| BAS32723 insulin, partial [Elaphe climacophora] 31143 Elaphe climacophora 93 1 51.2174 121 1.93395e-06 21 25 24 51 16 43 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQRLCGSHLVEALFLICGERGFYYSPRT NQ LCGSHLVEAL+L+CGERGF+ +P T 489 gi|77416515|sp|Q98TA8.1|INS_PANBU Q98TA8 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 8276 Pantodon buchholzi gi|13517225|gb|AAK28712.1| AAK28712 preproinsulin [Pantodon buchholzi] 8276 Pantodon buchholzi 110 1 51.6026 122 1.97371e-06 21 25 24 51 26 53 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SQHLCGSHLVDALYMVCGEKGFFYQPKT +QHLCGSHLV+ALY+VCGE+GFF P T 490 gi|1168923015|ref|XP_020504597.1| XP_020504597 insulin-like [Labrus bergylta] 56723 Labrus bergylta gi|1168947539|ref|XP_020516994.1| XP_020516994 insulin-like [Labrus bergylta] 56723 Labrus bergylta 121 1 51.6026 122 1.98529e-06 22 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGERGFFYNP QHLCGSHLV+ALYLVCGERGFF P 491 gi|699690926|ref|XP_009905017.1| XP_009905017 PREDICTED: insulin [Picoides pubescens] 118200 Picoides pubescens gi|678205215|gb|KFV72196.1| KFV72196 Insulin [Picoides pubescens] 118200 Picoides pubescens 107 1 51.2174 121 2.06607e-06 23 23 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATQHLCGSHLVEALYLVCGERGFFYYPKA QHLCGSHLVEALYLVCGERGFF P 492 gi|32171977|sp|P01340.1|INS_KATPE P01340 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8226 Katsuwonus pelamis 50 1 50.447 119 2.10186e-06 23 23 23 49 2 28 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANPHLCGSHLVEALYLVCGERGFFYQP N HLCGSHLVEALYLVCGERGFF P 493 gi|657808834|ref|XP_008331679.1| XP_008331679 insulin [Cynoglossus semilaevis] 244447 Cynoglossus semilaevis 113 1 51.2174 121 2.23122e-06 22 24 23 49 25 51 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP VAQHLCGSHLVDALYLVCGDRGFFYNP V QHLCGSHLV+ALYLVCG+RGFF P 494 gi|1188108584|ref|XP_020776332.1| XP_020776332 insulin-like [Boleophthalmus pectinirostris] 150288 Boleophthalmus pectinirostris 113 1 51.2174 121 2.61741e-06 22 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGERGFFYNP QHLCGSHLV+ALYLVCGERGFF P 495 gi|1357672134|ref|XP_024120213.1| XP_024120213 insulin [Oryzias melastigma] 30732 Oryzias melastigma 113 1 51.2174 121 2.69689e-06 22 23 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVEALYLVCGDRGFFYNP QHLCGSHLVEALYLVCG+RGFF P 496 gi|736252660|ref|XP_010788574.1| XP_010788574 PREDICTED: insulin [Notothenia coriiceps] 8208 Notothenia coriiceps 110 1 51.2174 121 2.71866e-06 22 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGERGFFYNP QHLCGSHLV+ALYLVCGERGFF P 497 gi|118572480|sp|P0C236.1|INS_POLSE P0C236 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 55291 Polypterus senegalus 52 1 50.0618 118 2.72164e-06 22 23 23 49 2 28 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANRHLCGSHLVEALYLVCGNRGFFYIP N+HLCGSHLVEALYLVCG RGFF P 498 gi|1311695|gb|AAB36058.1| AAB36058 insulin B-chain [Lampetra fluviatilis=river lamprey, pancreatic tissues, Peptide, 36 aa] 7748 Lampetra fluviatilis 36 1 50.0618 118 2.73131e-06 21 23 24 49 8 33 26 0 NQHLCGSHLVEALYLVCGERGFFXTP GTHLCGSHLVEALYVVCGDRGFFYTP HLCGSHLVEALY+VCG+RGFF TP 499 gi|410929826|ref|XP_003978300.1| XP_003978300 PREDICTED: insulin [Takifugu rubripes] 31033 Takifugu rubripes 120 1 51.2174 121 2.73753e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 500 gi|2392264|pdb|1DEI|B 1DEI_B Chain B, DESHEPTAPEPTIDE (B24-B30) INSULIN 9823 Sus scrofa gi|2392266|pdb|1DEI|D 1DEI_D Chain D, DESHEPTAPEPTIDE (B24-B30) INSULIN 9823 Sus scrofa 23 1 50.0618 118 2.74076e-06 23 23 22 44 1 23 23 0 FVNQHLCGSHLVEALYLVCGERG FVNQHLCGSHLVEALYLVCGERG FVNQHLCGSHLVEALYLVCGERG 501 gi|657340877|sp|C0HJI3.1|INS2_KATPE C0HJI3 RecName: Full=Insulin-2; Contains: RecName: Full=Insulin-2 B chain; Contains: RecName: Full=Insulin-2 A chain 8226 Katsuwonus pelamis 51 1 50.0618 118 2.76831e-06 22 23 25 49 5 29 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGERGFFYNP QHLCGSHLV+ALYLVCGERGFF P 502 gi|1308568151|ref|XP_023152986.1| XP_023152986 insulin [Amphiprion ocellaris] 80972 Amphiprion ocellaris 116 1 51.2174 121 2.80732e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 503 gi|551488033|ref|XP_005795593.1| XP_005795593 insulin-like [Xiphophorus maculatus] 8083 Xiphophorus maculatus gi|1316083891|ref|XP_023184301.1| XP_023184301 insulin-like [Xiphophorus maculatus] 8083 Xiphophorus maculatus 111 1 50.8322 120 2.93742e-06 20 24 24 49 26 51 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQHLCGSHLVDALYFICGERGFYYSP NQHLCGSHLV+ALY +CGERGF+ +P 504 gi|47221426|emb|CAF97344.1| CAF97344 unnamed protein product, partial [Tetraodon nigroviridis] 99883 Tetraodon nigroviridis 114 1 50.8322 120 2.9409e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 505 gi|961915412|ref|XP_014859806.1| XP_014859806 PREDICTED: insulin-like [Poecilia mexicana] 48701 Poecilia mexicana 111 1 50.8322 120 2.99667e-06 20 24 24 49 26 51 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQHLCGSHLVDALYFICGERGFYYSP NQHLCGSHLV+ALY +CGERGF+ +P 506 gi|226149|prf||1412252B 1412252B insulin B 8018 Oncorhynchus keta 29 1 49.6766 117 3.02033e-06 21 23 25 49 4 28 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 507 gi|1229025241|ref|XP_022077343.1| XP_022077343 insulin [Acanthochromis polyacanthus] 80966 Acanthochromis polyacanthus 116 1 50.8322 120 3.13166e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 508 gi|617489636|ref|XP_007577841.1| XP_007577841 PREDICTED: insulin-like [Poecilia formosa] 48698 Poecilia formosa gi|962017114|ref|XP_014880451.1| XP_014880451 PREDICTED: insulin-like [Poecilia latipinna] 48699 Poecilia latipinna 111 1 50.8322 120 3.27834e-06 20 24 24 49 26 51 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQHLCGSHLVDALYFICGERGFYNSP NQHLCGSHLV+ALY +CGERGF+ +P 509 gi|551524751|ref|XP_005813858.1| XP_005813858 insulin isoform X2 [Xiphophorus maculatus] 8083 Xiphophorus maculatus 117 1 50.8322 120 3.37806e-06 21 24 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYSP QHLCGSHLV+ALYLVCG+RGFF +P 510 gi|742207409|ref|XP_010895347.1| XP_010895347 PREDICTED: insulin [Esox lucius] 8010 Esox lucius 106 1 50.8322 120 3.38379e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 511 gi|617508818|ref|XP_007542379.1| XP_007542379 PREDICTED: insulin isoform X2 [Poecilia formosa] 48698 Poecilia formosa gi|658888097|ref|XP_008426908.1| XP_008426908 PREDICTED: insulin isoform X2 [Poecilia reticulata] 8081 Poecilia reticulata gi|961996363|ref|XP_014875092.1| XP_014875092 PREDICTED: insulin isoform X2 [Poecilia latipinna] 48699 Poecilia latipinna gi|962006852|ref|XP_014830200.1| XP_014830200 PREDICTED: insulin isoform X2 [Poecilia mexicana] 48701 Poecilia mexicana 117 1 50.8322 120 3.41175e-06 21 24 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYSP QHLCGSHLV+ALYLVCG+RGFF +P 512 gi|60392482|sp|P69045.1|INS_LOPAM P69045 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 8073 Lophius americanus gi|64026|emb|CAA23907.1| CAA23907 unnamed protein product [Lophius americanus] 8073 Lophius americanus 116 1 50.8322 120 3.45874e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 513 gi|1387715269|gb|PWA14592.1| PWA14592 hypothetical protein CCH79_00017606, partial [Gambusia affinis] 33528 Gambusia affinis 128 1 50.8322 120 3.47334e-06 21 24 25 49 40 64 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYSP QHLCGSHLV+ALYLVCG+RGFF +P 514 gi|32172007|sp|P12708.1|INS_PTYDH P12708 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8587 Ptyas dhumnades 51 1 50.0618 118 3.48276e-06 21 25 24 51 3 30 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQRLCGSHLVEALFLICGERGFYYSPRT NQ LCGSHLVEAL+L+CGERGF+ +P T 515 gi|657340873|sp|C0HJI7.1|INS1_HUSDA C0HJI7 RecName: Full=Insulin-1; Contains: RecName: Full=Insulin-1 B chain; Contains: RecName: Full=Insulin-1 A chain 55293 Huso dauricus 58 1 50.0618 118 3.65566e-06 24 25 23 49 7 34 28 1 VNQHL-CGSHLVEALYLVCGERGFFXTP ANQHLWCGAHLVEALYLVCGERGFFYTP NQHL CG+HLVEALYLVCGERGFF TP 516 gi|159162440|pdb|1HUI|B 1HUI_B Chain B, INSULIN MUTANT (B1, B10, B16, B27)GLU, DES-B30, NMR, 25 STRUCTURES 9606 Homo sapiens gi|159162499|pdb|1IOG|B 1IOG_B Chain B, INSULIN MUTANT A3 GLY,(B1, B10, B16, B27)GLU, DES-B30, NMR, 19 STRUCTURES 9606 Homo sapiens gi|159162501|pdb|1IOH|B 1IOH_B Chain B, INSULIN MUTANT A8 HIS,(B1, B10, B16, B27)GLU, DES-B30, NMR, 26 STRUCTURES 9606 Homo sapiens 29 1 49.6766 117 3.84593e-06 23 23 23 49 2 28 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP VNQHLCGSELVEALELVCGERGFFYEP VNQHLCGS LVEAL LVCGERGFF P 517 gi|961996359|ref|XP_014875091.1| XP_014875091 PREDICTED: insulin isoform X1 [Poecilia latipinna] 48699 Poecilia latipinna gi|962006848|ref|XP_014830199.1| XP_014830199 PREDICTED: insulin isoform X1 [Poecilia mexicana] 48701 Poecilia mexicana gi|1025490522|ref|XP_016521686.1| XP_016521686 PREDICTED: insulin isoform X1 [Poecilia formosa] 48698 Poecilia formosa 140 1 50.8322 120 3.89667e-06 21 24 25 49 52 76 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYSP QHLCGSHLV+ALYLVCG+RGFF +P 518 gi|658869811|ref|XP_008417822.1| XP_008417822 PREDICTED: insulin-like [Poecilia reticulata] 8081 Poecilia reticulata 111 1 50.447 119 3.92307e-06 20 24 24 49 26 51 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQHLCGSHLVDALYFICGERGFYYSP NQHLCGSHLV+ALY +CGERGF+ +P 519 gi|1143354975|ref|XP_019935205.1| XP_019935205 PREDICTED: insulin-like [Paralichthys olivaceus] 8255 Paralichthys olivaceus 111 1 50.447 119 3.96238e-06 26 30 5 49 5 51 47 2 QCCTSICSLYQL--ENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP QCAVSLMLLLVLYSRGMSSAPAQHLCGSHLVDALYFVCGERGFFFSP QC S+ L L + QHLCGSHLV+ALY VCGERGFF +P 520 gi|657585476|ref|XP_008296936.1| XP_008296936 PREDICTED: insulin [Stegastes partitus] 144197 Stegastes partitus 116 1 50.8322 120 3.97447e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 521 gi|1039368250|ref|XP_017164026.1| XP_017164026 PREDICTED: insulin isoform X1 [Poecilia reticulata] 8081 Poecilia reticulata 140 1 50.8322 120 4.09208e-06 21 24 25 49 52 76 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYSP QHLCGSHLV+ALYLVCG+RGFF +P 522 gi|1104896835|ref|XP_019064851.1| XP_019064851 PREDICTED: insulin isoform X1 [Fukomys damarensis] 885580 Fukomys damarensis 111 1 50.447 119 4.12355e-06 21 23 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNRHLCGSHLVEALYRACGDDGFFYKP FVN+HLCGSHLVEALY CG+ GFF P 523 gi|1250118764|ref|XP_022600464.1| XP_022600464 insulin [Seriola dumerili] 41447 Seriola dumerili gi|109240262|dbj|BAE96120.1| BAE96120 insulin [Seriola dumerili] 41447 Seriola dumerili 116 1 50.447 119 4.1354e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 524 gi|1317097244|ref|XP_023259767.1| XP_023259767 insulin [Seriola lalandi dorsalis] 1841481 Seriola lalandi dorsalis gi|1317097246|ref|XP_023259768.1| XP_023259768 insulin [Seriola lalandi dorsalis] 1841481 Seriola lalandi dorsalis 117 1 50.447 119 4.16032e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 525 gi|1911406|gb|AAB50640.1| AAB50640 insulin B-chain [Tilapia nilotica=Nile tilapia, Brockmann body, Peptide, 30 aa] 8128 Oreochromis niloticus gi|1582199|prf||2118237B 2118237B insulin:SUBUNIT=B chain 8128 Oreochromis niloticus 30 1 49.2914 116 4.20759e-06 21 23 25 49 5 29 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 526 gi|928052156|ref|XP_013875263.1| XP_013875263 PREDICTED: insulin-like [Austrofundulus limnaeus] 52670 Austrofundulus limnaeus 100 1 50.447 119 4.30076e-06 22 24 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QYLCGSHLVDALYLVCGERGFFYRPRT Q+LCGSHLV+ALYLVCGERGFF P T 527 gi|1316042055|ref|XP_023198434.1| XP_023198434 insulin isoform X1 [Xiphophorus maculatus] 8083 Xiphophorus maculatus 140 1 50.8322 120 4.33952e-06 21 24 25 49 52 76 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYSP QHLCGSHLV+ALYLVCG+RGFF +P 528 gi|319960387|gb|ADV90806.1| ADV90806 insulin [Micropterus salmoides] 27706 Micropterus salmoides 116 1 50.447 119 4.3457e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 529 gi|1041142453|ref|XP_017296161.1| XP_017296161 insulin [Kryptolebias marmoratus] 37003 Kryptolebias marmoratus 114 1 50.447 119 4.37803e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 530 gi|731241165|ref|XP_010633950.1| XP_010633950 PREDICTED: insulin isoform X2 [Fukomys damarensis] 885580 Fukomys damarensis gi|676273624|gb|KFO28273.1| KFO28273 Insulin [Fukomys damarensis] 885580 Fukomys damarensis 110 1 50.447 119 4.39051e-06 21 23 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNRHLCGSHLVEALYRACGDDGFFYKP FVN+HLCGSHLVEALY CG+ GFF P 531 gi|185135479|ref|NP_001118141.1| NP_001118141 preproinsulin 1 precursor [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss gi|126013515|gb|ABN69072.1| ABN69072 preproinsulin 1 [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss 105 1 50.447 119 4.39945e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 532 gi|927028752|dbj|BAS32713.1| BAS32713 insulin, partial [Tarentola mauritanica] 8569 Tarentola mauritanica 91 1 50.0618 118 4.48768e-06 21 23 22 51 16 45 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT YPNQRLCGPHLVEALYLVCGERGFYYAPKA + NQ LCG HLVEALYLVCGERGF+ P 533 gi|1367467335|ref|XP_024289867.1| XP_024289867 insulin [Oncorhynchus tshawytscha] 74940 Oncorhynchus tshawytscha 105 1 50.447 119 4.57932e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 534 gi|209736636|gb|ACI69187.1| ACI69187 Insulin precursor [Salmo salar] 8030 Salmo salar 105 1 50.447 119 4.57932e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 535 gi|1079745999|ref|XP_018542510.1| XP_018542510 PREDICTED: insulin [Lates calcarifer] 8187 Lates calcarifer gi|1079746189|ref|XP_018542614.1| XP_018542614 PREDICTED: insulin [Lates calcarifer] 8187 Lates calcarifer 116 1 50.447 119 4.61215e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 536 gi|573888010|ref|XP_006631776.1| XP_006631776 PREDICTED: insulin-like [Lepisosteus oculatus] 7918 Lepisosteus oculatus 111 1 50.447 119 4.69378e-06 22 22 23 49 26 52 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ANQHLCGSHLAEALYLVCGERGFTYDP NQHLCGSHL EALYLVCGERGF P 537 gi|642083529|emb|CDQ85029.1| CDQ85029 unnamed protein product [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss 107 1 50.447 119 4.6983e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 538 gi|1158872620|ref|XP_020340217.1| XP_020340217 insulin [Oncorhynchus kisutch] 8019 Oncorhynchus kisutch 105 1 50.447 119 4.86293e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 539 gi|185135495|ref|NP_001118142.1| NP_001118142 preproinsulin 2 precursor [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss gi|126013517|gb|ABN69073.1| ABN69073 preproinsulin 2 [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss 107 1 50.447 119 4.88996e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 540 gi|929086128|ref|XP_014053670.1| XP_014053670 PREDICTED: insulin-like [Salmo salar] 8030 Salmo salar 139 1 50.447 119 4.95925e-06 21 23 25 49 60 84 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 541 gi|1343036455|ref|XP_023868289.1| XP_023868289 insulin [Salvelinus alpinus] 8036 Salvelinus alpinus 105 1 50.447 119 4.9613e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 542 gi|32171974|sp|P01336.1|INS_GADMC P01336 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8053 Gadus morhua callarias gi|69335|pir||INCD INCD insulin - cod (Gadus sp.) 8051 Gadus sp. 51 1 49.6766 117 5.01659e-06 21 23 25 49 5 29 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 543 gi|642117245|emb|CDQ66972.1| CDQ66972 unnamed protein product [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss 105 1 50.0618 118 5.16401e-06 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 544 gi|1158944019|ref|XP_020320473.1| XP_020320473 insulin-like [Oncorhynchus kisutch] 8019 Oncorhynchus kisutch gi|1367392523|ref|XP_024258689.1| XP_024258689 insulin-like [Oncorhynchus tshawytscha] 74940 Oncorhynchus tshawytscha gi|1367392525|ref|XP_024258690.1| XP_024258690 insulin-like [Oncorhynchus tshawytscha] 74940 Oncorhynchus tshawytscha 142 1 50.447 119 5.26261e-06 21 23 25 49 61 85 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 545 gi|1343044463|ref|XP_023824401.1| XP_023824401 insulin [Salvelinus alpinus] 8036 Salvelinus alpinus 142 1 50.447 119 5.31434e-06 21 23 25 49 61 85 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 546 gi|1079724211|ref|XP_018530993.1| XP_018530993 PREDICTED: insulin-like [Lates calcarifer] 8187 Lates calcarifer 111 1 50.0618 118 5.34238e-06 21 23 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYFVCGERGFFYSP QHLCGSHLV+ALY VCGERGFF +P 547 gi|583979780|ref|XP_006785215.1| XP_006785215 PREDICTED: insulin-like [Neolamprologus brichardi] 32507 Neolamprologus brichardi 113 1 50.447 119 5.35943e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 548 gi|1169037057|ref|XP_020470849.1| XP_020470849 insulin [Monopterus albus] 43700 Monopterus albus 116 1 50.447 119 5.40481e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 549 gi|12644021|sp|P81025.2|INS_ORENI P81025 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 8128 Oreochromis niloticus gi|4558782|gb|AAD22742.1| AAD22742 insulin precursor [Oreochromis niloticus] 8128 Oreochromis niloticus 113 1 50.0618 118 5.41294e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 550 gi|60672456|gb|AAX33334.1| AAX33334 insulin, partial [Hydrochoerus hydrochaeris] 10149 Hydrochoerus hydrochaeris 51 1 49.2914 116 5.68466e-06 19 24 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FINRHLCGSHLVDALYSACGDKGFFYVP F+N+HLCGSHLV+ALY CG++GFF P 551 gi|60392483|sp|P69046.1|INS_LOPPI P69046 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8074 Lophius piscatorius 51 1 49.2914 116 5.68466e-06 21 23 25 49 5 29 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 552 gi|348542509|ref|XP_003458727.1| XP_003458727 PREDICTED: insulin isoform X2 [Oreochromis niloticus] 8128 Oreochromis niloticus gi|548541649|ref|XP_005753321.1| XP_005753321 PREDICTED: insulin [Pundamilia nyererei] 303518 Pundamilia nyererei gi|554882918|ref|XP_005951176.1| XP_005951176 PREDICTED: insulin [Haplochromis burtoni] 8153 Haplochromis burtoni gi|939308541|ref|XP_014269109.1| XP_014269109 insulin [Maylandia zebra] 106582 Maylandia zebra 113 1 50.0618 118 5.74533e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 553 gi|32171983|sp|P07453.1|INS_MYOSC P07453 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8097 Myoxocephalus scorpius 50 1 49.2914 116 5.90624e-06 21 23 25 49 4 28 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 554 gi|32172043|sp|P01339.1|INS_THUTH P01339 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8237 Thunnus thynnus gi|657340878|sp|C0HJI6.1|INS2_THUOR C0HJI6 RecName: Full=Insulin-2; Contains: RecName: Full=Insulin-2 B chain; Contains: RecName: Full=Insulin-2 A chain 8238 Thunnus orientalis gi|657340879|sp|C0HJI1.1|INS_CARSE C0HJI1 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 173346 Caranx sexfasciatus gi|1109545982|sp|C0HJT9.1|INS_SERQU C0HJT9 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8161 Seriola quinqueradiata gi|69339|pir||INTU2 INTU2 insulin 2 - tuna [Scombridae gen. sp.] 8233 Scombridae gen. sp. 51 1 49.2914 116 5.9265e-06 21 23 25 49 5 29 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 555 gi|1002599382|ref|XP_015678733.1| XP_015678733 PREDICTED: insulin [Protobothrops mucrosquamatus] 103944 Protobothrops mucrosquamatus 104 1 50.0618 118 6.01321e-06 20 25 24 51 27 54 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQRLCGSHLVEALFLICGERGFYYSPRS NQ LCGSHLVEAL+L+CGERGF+ +P + 556 gi|60392470|sp|P68989.1|INS_ONCGO P68989 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8017 Oncorhynchus gorbuscha gi|60392473|sp|P68990.1|INS_ONCKI P68990 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8019 Oncorhynchus kisutch gi|227195|prf||1616203A 1616203A insulin 8018 Oncorhynchus keta gi|227196|prf||1616203B 1616203B insulin 8017 Oncorhynchus gorbuscha 50 1 49.2914 116 6.03061e-06 21 23 25 49 4 28 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 557 gi|13517217|gb|AAK28708.1| AAK28708 preproinsulin, partial [Ambloplites rupestris] 109273 Ambloplites rupestris 91 1 50.0618 118 6.08315e-06 21 23 25 49 4 28 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 558 gi|565311786|gb|ETE64549.1| ETE64549 Insulin [Ophiophagus hannah] 8665 Ophiophagus hannah 103 1 50.0618 118 6.08575e-06 20 24 24 49 25 50 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NQRLCGSHLVEALFLICGERGFYYSP NQ LCGSHLVEAL+L+CGERGF+ +P 559 gi|32172037|sp|P01337.1|INS1_BATSP P01337 RecName: Full=Insulin-1 8066 Batrachoididae gen. sp. 51 1 49.2914 116 6.11459e-06 21 23 25 49 5 29 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 560 gi|831496028|ref|XP_012708882.1| XP_012708882 insulin [Fundulus heteroclitus] 8078 Fundulus heteroclitus 116 1 50.0618 118 6.20869e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 561 gi|657340880|sp|C0HJI4.1|INS_PAGMA C0HJI4 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 143350 Pagrus major gi|1109545981|sp|C0HJU0.1|INS_PLATA C0HJU0 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 334891 Platax teira 51 1 49.2914 116 6.24327e-06 21 23 25 49 5 29 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 562 gi|60392464|sp|P68987.1|INS_PETMA P68987 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7757 Petromyzon marinus gi|60392467|sp|P68988.1|INS_LAMFL P68988 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7748 Lampetra fluviatilis 57 1 49.2914 116 6.6518e-06 21 23 26 49 10 33 24 0 HLCGSHLVEALYLVCGERGFFXTP HLCGSHLVEALYVVCGDRGFFYTP HLCGSHLVEALY+VCG+RGFF TP 563 gi|1110881874|ref|XP_019219195.1| XP_019219195 PREDICTED: insulin isoform X1 [Oreochromis niloticus] 8128 Oreochromis niloticus 123 1 50.0618 118 6.96479e-06 21 23 25 49 39 63 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDRGFFYNP QHLCGSHLV+ALYLVCG+RGFF P 564 gi|23379796|gb|AAM76640.1| AAM76640 insulin, partial [Gorilla gorilla] 9593 Gorilla gorilla gi|23379798|gb|AAM76641.1| AAM76641 insulin, partial [Pongo pygmaeus] 9600 Pongo pygmaeus 65 1 49.2914 116 7.83466e-06 22 22 28 51 1 24 24 0 CGSHLVEALYLVCGERGFFXTPXT CGSHLVEALYLVCGERGFFYTPKT CGSHLVEALYLVCGERGFF TP T 565 gi|974082496|ref|XP_015239095.1| XP_015239095 PREDICTED: insulin [Cyprinodon variegatus] 28743 Cyprinodon variegatus 117 1 49.6766 117 7.838e-06 21 23 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGERGFYYRP QHLCGSHLV+ALYLVCGERGF+ P 566 gi|228833|prf||1812293B 1812293B insulin:SUBUNIT=B 7933 Anguilliformes 29 1 48.521 114 7.8507e-06 20 23 25 49 4 28 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGDKGFFFNP QHLCGSHLV+ALYLVCG++GFF P 567 gi|927028754|dbj|BAS32714.1| BAS32714 insulin, partial [Teratoscincus roborowskii] 102174 Teratoscincus roborowskii 91 1 49.6766 117 7.99558e-06 21 23 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQRLCGPHLVEALYLVCGERGFYYAP F +Q LCG HLVEALYLVCGERGF+ P 568 gi|1007704491|ref|XP_015812318.1| XP_015812318 PREDICTED: insulin-like [Nothobranchius furzeri] 105023 Nothobranchius furzeri 111 1 49.6766 117 8.43954e-06 21 22 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYFVCGERGFFYNP QHLCGSHLV+ALY VCGERGFF P 569 gi|32171971|sp|P01334.1|INS_CROAT P01334 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8730 Crotalus atrox 51 1 48.9062 115 8.44303e-06 20 25 24 51 3 30 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT NQRLCGSHLVEALFLICGERGFYYSPRS NQ LCGSHLVEAL+L+CGERGF+ +P + 570 gi|808863459|gb|KKF14785.1| KKF14785 Insulin [Larimichthys crocea] 215358 Larimichthys crocea 448 1 52.373 124 8.86158e-06 20 22 25 49 361 385 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYMVCGPRGFFYNP QHLCGSHLV+ALY+VCG RGFF P 571 gi|831303543|ref|XP_012683874.1| XP_012683874 PREDICTED: insulin [Clupea harengus] 7950 Clupea harengus 117 1 49.6766 117 9.54956e-06 21 23 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEQGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 572 gi|927028760|dbj|BAS32717.1| BAS32717 insulin [Coleonyx mitratus] 449391 Coleonyx mitratus 101 1 49.2914 116 9.78236e-06 21 23 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FPSQRLCGPHLVEALYLVCGERGFYYAPKA F +Q LCG HLVEALYLVCGERGF+ P 573 gi|927028758|dbj|BAS32716.1| BAS32716 insulin [Eublepharis macularius] 481883 Eublepharis macularius 101 1 49.2914 116 1.04925e-05 21 23 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT FPSQRLCGPHLVEALYLVCGERGFYYAPKA F +Q LCG HLVEALYLVCGERGF+ P 574 gi|64362|emb|CAA24983.1| CAA24983 preproinsulin [Oncorhynchus keta] 8018 Oncorhynchus keta 105 1 49.2914 116 1.1368e-05 21 23 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGLHLVDALYLVCGEKGFFYTP QHLCG HLV+ALYLVCGE+GFF TP 575 gi|1342983128|ref|XP_023847862.1| XP_023847862 insulin-like [Salvelinus alpinus] 8036 Salvelinus alpinus 112 1 48.9062 115 1.50827e-05 21 23 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEQGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 576 gi|929113902|ref|XP_014068347.1| XP_014068347 PREDICTED: insulin-like [Salmo salar] 8030 Salmo salar 114 1 48.9062 115 1.53991e-05 21 23 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEQGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 577 gi|32172019|sp|P29335.1|INS_AMICA P29335 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7924 Amia calva 52 1 48.1358 113 1.62978e-05 21 23 23 49 2 28 27 0 VNQHLCGSHLVEALYLVCGERGFFXTP ASQHLCGSHLVEALFLVCGESGFFYNP +QHLCGSHLVEAL+LVCGE GFF P 578 gi|1158915627|ref|XP_020362902.1| XP_020362902 insulin-like [Oncorhynchus kisutch] 8019 Oncorhynchus kisutch 115 1 48.9062 115 1.69156e-05 21 23 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEQGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 579 gi|1367457307|ref|XP_024284520.1| XP_024284520 insulin-like [Oncorhynchus tshawytscha] 74940 Oncorhynchus tshawytscha gi|1367457309|ref|XP_024284521.1| XP_024284521 insulin-like [Oncorhynchus tshawytscha] 74940 Oncorhynchus tshawytscha 115 1 48.9062 115 1.79461e-05 21 23 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEQGFFYNP QHLCGSHLV+ALYLVCGE+GFF P 580 gi|1109001231|ref|XP_019131764.1| XP_019131764 PREDICTED: insulin [Larimichthys crocea] 215358 Larimichthys crocea 116 1 48.9062 115 1.9132e-05 20 22 25 49 29 53 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYMVCGPRGFFYNP QHLCGSHLV+ALY+VCG RGFF P 581 gi|1129960509|ref|XP_019739962.1| XP_019739962 PREDICTED: insulin-like [Hippocampus comes] 109280 Hippocampus comes 111 1 48.521 114 1.9978e-05 20 22 24 49 26 51 26 0 NQHLCGSHLVEALYLVCGERGFFXTP THHLCGSHLVDALYFVCGERGFFHSP HLCGSHLV+ALY VCGERGFF +P 582 gi|927161195|ref|XP_013919491.1| XP_013919491 PREDICTED: insulin [Thamnophis sirtalis] 35019 Thamnophis sirtalis 104 1 48.521 114 2.07196e-05 20 25 24 51 27 54 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SERLCGSHLVEALFLVCGERGFYYSPRT ++ LCGSHLVEAL+LVCGERGF+ +P T 583 gnl|mdb|bmrb1023:1 bmrb1023:1 insulin B chain 42 1 47.7506 112 2.08531e-05 22 22 22 43 1 22 22 0 FVNQHLCGSHLVEALYLVCGER FVNQHLCGSHLVEALYLVCGER FVNQHLCGSHLVEALYLVCGER 584 gi|498936605|ref|XP_004541197.1| XP_004541197 insulin [Maylandia zebra] 106582 Maylandia zebra gi|548333555|ref|XP_005719626.1| XP_005719626 PREDICTED: insulin-like [Pundamilia nyererei] 303518 Pundamilia nyererei gi|554811369|ref|XP_005916546.1| XP_005916546 PREDICTED: insulin-like [Haplochromis burtoni] 8153 Haplochromis burtoni gi|908434518|ref|XP_003445871.3| XP_003445871 PREDICTED: insulin [Oreochromis niloticus] 8128 Oreochromis niloticus 111 1 48.1358 113 2.63406e-05 20 22 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP KHLCGSHLVDALYFVCGERGFFYNP +HLCGSHLV+ALY VCGERGFF P 585 gi|209731392|gb|ACI66565.1| ACI66565 Insulin precursor [Salmo salar] 8030 Salmo salar 105 1 48.1358 113 2.83705e-05 20 22 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGLFYNP QHLCGSHLV+ALYLVCGE+G F P 586 gi|583972760|ref|XP_006781789.1| XP_006781789 PREDICTED: insulin-like [Neolamprologus brichardi] 32507 Neolamprologus brichardi 111 1 48.1358 113 2.90713e-05 20 22 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP RHLCGSHLVDALYFVCGERGFFYNP +HLCGSHLV+ALY VCGERGFF P 587 gi|929231326|ref|XP_013992220.1| XP_013992220 PREDICTED: insulin [Salmo salar] 8030 Salmo salar gi|209736270|gb|ACI69004.1| ACI69004 Insulin precursor [Salmo salar] 8030 Salmo salar 105 1 48.1358 113 3.0409e-05 20 22 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGEKGLFYNP QHLCGSHLV+ALYLVCGE+G F P 588 gi|13517227|gb|AAK28713.1| AAK28713 preproinsulin, partial [Osteoglossum bicirrhosum] 109271 Osteoglossum bicirrhosum 111 1 48.1358 113 3.05405e-05 19 24 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QRLCGSHLVDALYMVCGDRGFFYSPKS Q LCGSHLV+ALY+VCG+RGFF +P + 589 gi|1357673497|ref|XP_024121986.1| XP_024121986 insulin-like [Oryzias melastigma] 30732 Oryzias melastigma 104 1 48.1358 113 3.40377e-05 20 22 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVEALYIVCGDGGFFYNP QHLCGSHLVEALY+VCG+ GFF P 590 gi|1083315093|ref|XP_018607388.1| XP_018607388 PREDICTED: insulin [Scleropages formosus] 113540 Scleropages formosus gi|938048876|gb|KPP58103.1| KPP58103 preproinsulin-like [Scleropages formosus] 113540 Scleropages formosus 111 1 48.1358 113 3.40379e-05 19 24 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QRLCGSHLVDALYMVCGDRGFFYSPKS Q LCGSHLV+ALY+VCG+RGFF +P + 591 gi|1169000055|ref|XP_020455439.1| XP_020455439 insulin-like [Monopterus albus] 43700 Monopterus albus 112 1 47.7506 112 3.62896e-05 20 23 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT IASQHLCGPHLVKALHLVCGERGFLYMPRT +QHLCG HLV+AL+LVCGERGF P T 592 gi|657340874|sp|C0HJI2.1|INS1_KATPE C0HJI2 RecName: Full=Insulin-1; Contains: RecName: Full=Insulin-1 B chain; Contains: RecName: Full=Insulin-1 A chain 8226 Katsuwonus pelamis 50 1 46.9802 110 3.83093e-05 21 23 24 49 3 28 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SQHLCGSHLVEALNLVCGDRGFFYNP +QHLCGSHLVEAL LVCG+RGFF P 593 gi|32172025|sp|P42633.1|INS_ANGRO P42633 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7938 Anguilla rostrata 51 1 46.9802 110 3.8405e-05 21 21 25 49 4 28 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVEALYLVCGSNGFFFNP QHLCGSHLVEALYLVCG GFF P 594 gi|12643999|sp|P13190.2|INS_CALMI P13190 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 7868 Callorhinchus milii 89 1 47.7506 112 3.85914e-05 20 22 25 49 4 28 25 0 QHLCGSHLVEALYLVCGERGFFXTP QRLCGSHLVDALYFVCGERGFFYSP Q LCGSHLV+ALY VCGERGFF +P 595 gi|657340875|sp|C0HJI5.1|INS1_THUOR C0HJI5 RecName: Full=Insulin-1; Contains: RecName: Full=Insulin-1 B chain; Contains: RecName: Full=Insulin-1 A chain 8238 Thunnus orientalis 50 1 46.9802 110 3.95177e-05 21 23 24 49 3 28 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SQHLCGSHLVEALNLVCGDRGFFYNP +QHLCGSHLVEAL LVCG+RGFF P 596 gi|1042345504|ref|XP_017315312.1| XP_017315312 PREDICTED: insulin-like [Ictalurus punctatus] 7998 Ictalurus punctatus 108 1 47.7506 112 4.0412e-05 26 27 13 49 11 51 41 4 LYQLENYCNFVN----QHLCGSHLVEALYLVCGERGFFXTP LFLLAFYSGGVNAVAPQHLCGSHLVEALYLVCGPNGFFYNP L+ L Y VN QHLCGSHLVEALYLVCG GFF P 597 gi|632973097|ref|XP_007902984.1| XP_007902984 PREDICTED: insulin [Callorhinchus milii] 7868 Callorhinchus milii 113 1 47.7506 112 4.14353e-05 20 22 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QRLCGSHLVDALYFVCGERGFFYSP Q LCGSHLV+ALY VCGERGFF +P 598 gi|213451|gb|AAA49417.1| AAA49417 insulin B-chain, partial [Oncorhynchus keta] 8018 Oncorhynchus keta 25 1 46.595 109 4.99443e-05 20 22 26 49 1 24 24 0 HLCGSHLVEALYLVCGERGFFXTP QLCGSHLVDALYLVCGEKGFFYTP LCGSHLV+ALYLVCGE+GFF TP 599 gi|1250136609|ref|XP_022607673.1| XP_022607673 insulin-like [Seriola dumerili] 41447 Seriola dumerili 111 1 47.3654 111 5.30041e-05 20 22 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSRLVDALYFVCGERGFFYSP QHLCGS LV+ALY VCGERGFF +P 600 gi|1108995457|ref|XP_010735398.2| XP_010735398 PREDICTED: insulin-like [Larimichthys crocea] 215358 Larimichthys crocea gi|808865886|gb|KKF16676.1| KKF16676 Insulin [Larimichthys crocea] 215358 Larimichthys crocea 111 1 47.3654 111 5.35277e-05 20 22 25 48 27 50 24 0 QHLCGSHLVEALYLVCGERGFFXT QHLCGSHLVDALYFVCGERGFFYS QHLCGSHLV+ALY VCGERGFF + 601 gi|32172040|sp|P01338.1|INS2_BATSP P01338 RecName: Full=Insulin 2; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 8066 Batrachoididae gen. sp. 50 1 46.595 109 5.44587e-05 20 22 25 46 5 26 22 0 QHLCGSHLVEALYLVCGERGFF QHLCGSHLVDALYLVCGDRGFF QHLCGSHLV+ALYLVCG+RGFF 602 gi|1174644594|ref|XP_011478695.2| XP_011478695 insulin-like [Oryzias latipes] 8090 Oryzias latipes 145 1 47.3654 111 5.7738e-05 19 22 25 49 61 85 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALFFVCGDRGFFYNP QHLCGSHLV+AL+ VCG+RGFF P 603 gi|1317126169|ref|XP_023275064.1| XP_023275064 insulin-like [Seriola lalandi dorsalis] 1841481 Seriola lalandi dorsalis 111 1 47.3654 111 5.79064e-05 20 22 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSRLVDALYFVCGERGFFYSP QHLCGS LV+ALY VCGERGFF +P 604 gi|927028750|dbj|BAS32712.1| BAS32712 insulin, partial [Ptyodactylus guttatus] 502503 Ptyodactylus guttatus 91 1 46.9802 110 5.92205e-05 19 22 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP YPNQRLCGPHLVEAFFLVCGERGFYYAP + NQ LCG HLVEA +LVCGERGF+ P 605 gi|60392476|sp|P68991.1|INS_CHIMO P68991 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7871 Chimaera monstrosa gi|60392479|sp|P68992.1|INS_HYDCO P68992 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7873 Hydrolagus colliei 59 1 46.595 109 6.36233e-05 20 22 25 49 4 28 25 0 QHLCGSHLVEALYLVCGERGFFXTP QRLCGSHLVDALYFVCGERGFFYSP Q LCGSHLV+ALY VCGERGFF +P 606 gi|966707303|gb|KTG39544.1| KTG39544 hypothetical protein cypCar_00007439 [Cyprinus carpio] 7962 Cyprinus carpio 141 1 47.3654 111 6.36919e-05 23 29 2 46 79 123 45 0 IVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF LLLQAAAIILLLASLPGSLSTPSQHLCGSNLVDALYLVCGPRGFF ++ Q I L L + +QHLCGS+LV+ALYLVCG RGFF 607 gi|1357706823|ref|XP_024139573.1| XP_024139573 insulin-like isoform X2 [Oryzias melastigma] 30732 Oryzias melastigma gi|1357706825|ref|XP_024139574.1| XP_024139574 insulin-like isoform X2 [Oryzias melastigma] 30732 Oryzias melastigma gi|1357706827|ref|XP_024139575.1| XP_024139575 insulin-like isoform X2 [Oryzias melastigma] 30732 Oryzias melastigma 110 1 47.3654 111 6.42161e-05 19 22 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALFFVCGDRGFFYNP QHLCGSHLV+AL+ VCG+RGFF P 608 gi|470321|gb|AAA17540.1| AAA17540 insulin, partial [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 55 1 46.595 109 6.91407e-05 21 21 1 21 35 55 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 609 gi|1357706821|ref|XP_024139571.1| XP_024139571 insulin-like isoform X1 [Oryzias melastigma] 30732 Oryzias melastigma 148 1 47.3654 111 7.15951e-05 19 22 25 49 64 88 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALFFVCGDRGFFYNP QHLCGSHLV+AL+ VCG+RGFF P 610 gi|1101518356|ref|XP_018924728.1| XP_018924728 PREDICTED: insulin-like [Cyprinus carpio] 7962 Cyprinus carpio 109 1 46.9802 110 7.5537e-05 23 27 5 46 6 47 42 0 QCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF QAAAIILLLASLPGSLSTPSQHLCGSNLVDALYLVCGPRGFF Q I L L + +QHLCGS+LV+ALYLVCG RGFF 611 gi|1168957585|ref|XP_020446870.1| XP_020446870 insulin-like [Monopterus albus] 43700 Monopterus albus 129 1 46.9802 110 7.91076e-05 20 22 25 49 58 82 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYFVCGEWGFFYSP QHLCGSHLV+ALY VCGE GFF +P 612 gi|1199358872|ref|XP_012725338.2| XP_012725338 insulin-like [Fundulus heteroclitus] 8078 Fundulus heteroclitus 165 1 47.3654 111 8.21932e-05 18 21 25 49 81 105 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDTLYFLCGERGFYYRP QHLCGSHLV+ LY +CGERGF+ P 613 gi|1020523362|ref|XP_016101176.1| XP_016101176 PREDICTED: insulin-like [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 108 1 46.9802 110 8.29434e-05 23 27 5 46 6 47 42 0 QCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF QAAAIILLLASLPGSLSTPSQHLCGSNLVDALYLVCGPRGFF Q I L L + +QHLCGS+LV+ALYLVCG RGFF 614 gi|704164317|ref|XP_010129351.1| XP_010129351 PREDICTED: insulin [Buceros rhinoceros silvestris] 175836 Buceros rhinoceros silvestris gi|676711654|gb|KFO86572.1| KFO86572 Insulin [Buceros rhinoceros silvestris] 175836 Buceros rhinoceros silvestris 106 1 46.9802 110 8.37596e-05 21 22 23 46 26 49 24 0 VNQHLCGSHLVEALYLVCGERGFF ANQRLCGSNLVEALYLVCGERGFF NQ LCGS+LVEALYLVCGERGFF 615 gi|1101597287|ref|XP_018963803.1| XP_018963803 PREDICTED: insulin-like [Cyprinus carpio] 7962 Cyprinus carpio 108 1 46.9802 110 8.37628e-05 23 27 5 46 6 47 42 0 QCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF QAAAIILLLASLPGSLSTPSQHLCGSNLVDALYLVCGPRGFF Q I L L + +QHLCGS+LV+ALYLVCG RGFF 616 gi|966647774|gb|KTF82684.1| KTF82684 hypothetical protein cypCar_00023606 [Cyprinus carpio] 7962 Cyprinus carpio 144 1 46.9802 110 8.60524e-05 20 21 25 49 62 86 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 617 gi|1025192563|ref|XP_016403511.1| XP_016403511 PREDICTED: insulin-like [Sinocyclocheilus rhinocerous] 307959 Sinocyclocheilus rhinocerous 107 1 46.595 109 9.10719e-05 23 27 5 46 6 47 42 0 QCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF QAAAIILLLASLPGSLSTPSQHLCGSNLVDALYLVCGPRGFF Q I L L + +QHLCGS+LV+ALYLVCG RGFF 618 gi|1341391134|gb|AVA30823.1| AVA30823 insulin [Ctenopharyngodon idella] 7959 Ctenopharyngodon idella 108 1 46.595 109 9.61168e-05 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 619 gi|1101657960|ref|XP_018955441.1| XP_018955441 PREDICTED: insulin-like isoform X1 [Cyprinus carpio] 7962 Cyprinus carpio 117 1 46.595 109 0.000100718 20 21 25 49 35 59 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 620 gi|124594|sp|P01335.1|INS_CYPCA P01335 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 7962 Cyprinus carpio gi|62628|emb|CAA25496.1| CAA25496 unnamed protein product [Cyprinus carpio] 7962 Cyprinus carpio gi|224208|prf||1012233A 1012233A insulin,prepro 7962 Cyprinus carpio 108 1 46.595 109 0.000102957 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 621 gi|1101657958|ref|XP_018955433.1| XP_018955433 PREDICTED: insulin [Cyprinus carpio] 7962 Cyprinus carpio gi|966705252|gb|KTG37493.1| KTG37493 hypothetical protein cypCar_00000474 [Cyprinus carpio] 7962 Cyprinus carpio 137 1 46.595 109 0.000103172 20 21 25 49 56 80 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 622 gi|1268348951|gb|ATN38177.1| ATN38177 insulin [Labeo rohita] 84645 Labeo rohita 108 1 46.595 109 0.000103973 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 623 gi|13991923|gb|AAK51558.1|AF373021_1 AAK51558 preproinsulin [Catla catla] 72446 Catla catla 108 1 46.595 109 0.000103973 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 624 gi|597799071|ref|XP_007261072.1| XP_007261072 insulin [Astyanax mexicanus] 7994 Astyanax mexicanus 108 1 46.595 109 0.000106035 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPSGFFYNP QHLCGSHLV+ALYLVCG GFF P 625 gi|1101657962|ref|XP_018955450.1| XP_018955450 PREDICTED: insulin-like isoform X2 [Cyprinus carpio] 7962 Cyprinus carpio 109 1 46.595 109 0.000106517 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 626 gi|927028766|dbj|BAS32720.1| BAS32720 insulin, partial [Cordylus tropidosternum] 126612 Cordylus tropidosternum 97 1 46.595 109 0.000108047 18 24 24 49 18 43 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SEHLCGTHLVEALFLVCGDRGFYYNP ++HLCG+HLVEAL+LVCG+RGF+ P 627 gi|731187570|gb|AIZ50368.1| AIZ50368 insulin [Mylopharyngodon piceus] 75356 Mylopharyngodon piceus 108 1 46.595 109 0.000108138 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 628 gi|60672452|gb|AAX33332.1| AAX33332 insulin, partial [Galea musteloides] 10146 Galea musteloides 51 1 45.8246 107 0.00011239 18 24 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FFNRHLCGSNLVDALYVVCKDKGFFSMP F N+HLCGS+LV+ALY+VC ++GFF P 629 gi|32172031|sp|P81881.1|INS_PIAME P81881 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 42528 Piaractus mesopotamicus 52 1 45.8246 107 0.000112609 20 21 25 49 6 30 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPSGFFYNP QHLCGSHLV+ALYLVCG GFF P 630 gi|1188095661|ref|XP_020794365.1| XP_020794365 insulin-1-like [Boleophthalmus pectinirostris] 150288 Boleophthalmus pectinirostris 86 1 46.2098 108 0.000121576 19 23 22 49 23 50 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FSSQHLCGPHLVEALNMVCGDRGFYYNP F +QHLCG HLVEAL +VCG+RGF+ P 631 gi|1020474285|ref|XP_016142372.1| XP_016142372 PREDICTED: insulin [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami gi|1025384557|ref|XP_016401460.1| XP_016401460 PREDICTED: insulin [Sinocyclocheilus rhinocerous] 307959 Sinocyclocheilus rhinocerous 108 1 46.595 109 0.000121654 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 632 gi|1042344900|ref|XP_017314995.1| XP_017314995 PREDICTED: insulin-like [Ictalurus punctatus] 7998 Ictalurus punctatus 108 1 46.595 109 0.000122854 25 27 13 49 11 51 41 4 LYQLENYCNFVN----QHLCGSHLVEALYLVCGERGFFXTP LFVLAFYSAGVNAGAPQHLCGSHLVDALYLVCGPNGFFYNP L+ L Y VN QHLCGSHLV+ALYLVCG GFF P 633 gi|1024969761|ref|XP_016306245.1| XP_016306245 PREDICTED: insulin isoform X1 [Sinocyclocheilus anshuiensis] 1608454 Sinocyclocheilus anshuiensis gi|1024969763|ref|XP_016306246.1| XP_016306246 PREDICTED: insulin isoform X2 [Sinocyclocheilus anshuiensis] 1608454 Sinocyclocheilus anshuiensis 108 1 46.595 109 0.000122854 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 634 gi|952987607|gb|ALO24192.1| ALO24192 preproinsulin [Carassius auratus] 7957 Carassius auratus 108 1 46.2098 108 0.000124065 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 635 gi|1049259336|ref|XP_017569410.1| XP_017569410 PREDICTED: insulin [Pygocentrus nattereri] 42514 Pygocentrus nattereri 108 1 46.2098 108 0.000134192 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPSGFFYNP QHLCGSHLV+ALYLVCG GFF P 636 gi|13517219|gb|AAK28709.1| AAK28709 preproinsulin, partial [Catostomus commersonii] 7971 Catostomus commersonii 108 1 46.2098 108 0.000134192 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 637 gi|84794565|ref|NP_001034153.1| NP_001034153 preproinsulin b precursor [Danio rerio] 7955 Danio rerio gi|76782171|gb|ABA54856.1| ABA54856 preproinsulin 2 [Danio rerio] 7955 Danio rerio gi|190338086|gb|AAI62707.1| AAI62707 Preproinsulin b [Danio rerio] 7955 Danio rerio gi|190339492|gb|AAI62679.1| AAI62679 Preproinsulin b [Danio rerio] 7955 Danio rerio 107 1 46.2098 108 0.000137582 24 27 5 48 6 49 44 0 QCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXT QASVLILLLASLPGSQSSPSQHLCGSSLVDALYLVCGPRGFFYT Q I L L + +QHLCGS LV+ALYLVCG RGFF T 638 gi|497063|gb|AAB60473.1| AAB60473 preproinsulin I, partial [Mus spretus] 10096 Mus spretus 39 1 45.4394 106 0.000143648 20 21 1 21 19 39 21 0 GIVEQCCTSICSLYQLENYCN GIVDQCCTSICSLYQLENYCN GIV+QCCTSICSLYQLENYCN 639 gi|12053668|emb|CAC20109.1| CAC20109 insulin [Danio rerio] 7955 Danio rerio 108 1 46.2098 108 0.000143726 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 640 gi|497065|gb|AAB60474.1| AAB60474 preproinsulin II, partial [Mus spretus] 10096 Mus spretus 41 1 45.4394 106 0.00014514 20 21 1 21 21 41 21 0 GIVEQCCTSICSLYQLENYCN GIVDQCCTSICSLYQLENYCN GIV+QCCTSICSLYQLENYCN 641 gi|1228995621|ref|XP_022062538.1| XP_022062538 LOW QUALITY PROTEIN: insulin-like [Acanthochromis polyacanthus] 80966 Acanthochromis polyacanthus 149 1 46.595 109 0.000146102 19 22 25 48 65 88 24 0 QHLCGSHLVEALYLVCGERGFFXT QHLCGSHLVDALYFVCGERGFYYS QHLCGSHLV+ALY VCGERGF+ + 642 gi|18858895|ref|NP_571131.1| NP_571131 insulin preproprotein [Danio rerio] 7955 Danio rerio gi|9973509|sp|O73727.1|INS_DANRE O73727 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 7955 Danio rerio gi|2935704|gb|AAC41261.1| AAC41261 preproinsulin [Danio rerio] 7955 Danio rerio gi|63100509|gb|AAH95013.1| AAH95013 Preproinsulin [Danio rerio] 7955 Danio rerio gi|182891920|gb|AAI65526.1| AAI65526 Ins protein [Danio rerio] 7955 Danio rerio 108 1 46.2098 108 0.000150945 20 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSHLVDALYLVCGPTGFFYNP QHLCGSHLV+ALYLVCG GFF P 643 gi|149040368|gb|EDL94406.1| EDL94406 rCG57481, isoform CRA_a [Rattus norvegicus] 10116 Rattus norvegicus 93 1 45.8246 107 0.000164444 20 21 1 21 73 93 21 0 GIVEQCCTSICSLYQLENYCN GIVDQCCTSICSLYQLENYCN GIV+QCCTSICSLYQLENYCN 644 gi|208662|gb|AAA72170.1| AAA72170 insulin A chain [synthetic construct] 32630 synthetic construct 22 1 45.0542 105 0.000173572 21 21 1 21 2 22 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 645 gi|1109001238|ref|XP_019131766.1| XP_019131766 PREDICTED: uncharacterized protein LOC104931882 [Larimichthys crocea] 215358 Larimichthys crocea 217 1 47.3654 111 0.000176788 19 21 25 46 29 50 22 0 QHLCGSHLVEALYLVCGERGFF QHLCGSHLVDALYMVCGPRGFF QHLCGSHLV+ALY+VCG RGFF 646 gi|168988695|pdb|2QIU|A 2QIU_A Chain A, Structure Of Human Arg-Insulin 9606 Homo sapiens gi|168988697|pdb|2QIU|C 2QIU_C Chain C, Structure Of Human Arg-Insulin 9606 Homo sapiens gi|197724919|pdb|2R34|A 2R34_A Chain A, Crystal Structure Of Mn Human Arg-Insulin 9606 Homo sapiens gi|197724921|pdb|2R34|C 2R34_C Chain C, Crystal Structure Of Mn Human Arg-Insulin 9606 Homo sapiens gi|197724923|pdb|2R35|A 2R35_A Chain A, Crystal Structure Of Rb Human Arg-Insulin 9606 Homo sapiens gi|197724925|pdb|2R35|C 2R35_C Chain C, Crystal Structure Of Rb Human Arg-Insulin 9606 Homo sapiens gi|197724927|pdb|2R36|A 2R36_A Chain A, Crystal Structure Of Ni Human Arg-Insulin 32630 synthetic construct gi|197724929|pdb|2R36|C 2R36_C Chain C, Crystal Structure Of Ni Human Arg-Insulin 32630 synthetic construct 22 1 45.0542 105 0.000177222 21 21 1 21 2 22 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 647 gi|657540697|ref|XP_008276351.1| XP_008276351 PREDICTED: insulin-like [Stegastes partitus] 144197 Stegastes partitus 111 1 45.8246 107 0.000185846 19 22 25 48 27 50 24 0 QHLCGSHLVEALYLVCGERGFFXT QHLCGSHLVDALYFVCGERGFYYS QHLCGSHLV+ALY VCGERGF+ + 648 gi|1229749564|pdb|5MHD|A 5MHD_A Chain A, Biosynthetic engineered A22S-B3K-B31R human insulin monomer structure in water/acetonitrile solutions. 9606 Homo sapiens 22 1 45.0542 105 0.000186685 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 649 gnl|mdb|bmrb34070:1 bmrb34070:1 Insulin 22 1 45.0542 105 0.000186685 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 650 gi|1041107145|ref|XP_017276784.1| XP_017276784 insulin-like [Kryptolebias marmoratus] 37003 Kryptolebias marmoratus 100 1 45.8246 107 0.000187499 19 22 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGAHLVDALYLVCGDRGFHYRP QHLCG+HLV+ALYLVCG+RGF P 651 gi|1041104253|ref|XP_017275204.1| XP_017275204 insulin-like [Kryptolebias marmoratus] 37003 Kryptolebias marmoratus 111 1 45.8246 107 0.000206935 19 22 24 46 26 48 23 0 NQHLCGSHLVEALYLVCGERGFF SRHLCGSHLVDALYFVCGERGFF ++HLCGSHLV+ALY VCGERGFF 652 gi|231038|pdb|4INS|A 4INS_A Chain A, THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION 9823 Sus scrofa gi|231040|pdb|4INS|C 4INS_C Chain C, THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION 9823 Sus scrofa gi|231329|pdb|9INS|A 9INS_A Chain A, MONOVALENT CATION BINDING IN CUBIC INSULIN CRYSTALS 9823 Sus scrofa gi|443059|pdb|1IZA|A 1IZA_A Chain A, Role Of B13 Glu In Insulin Assembly: The Hexamer Structure Of Recombinant Mutant (B13 Glu-> Gln) Insulin 9823 Sus scrofa gi|443061|pdb|1IZA|C 1IZA_C Chain C, Role Of B13 Glu In Insulin Assembly: The Hexamer Structure Of Recombinant Mutant (B13 Glu-> Gln) Insulin 9823 Sus scrofa gi|443063|pdb|1IZB|A 1IZB_A Chain A, Role Of B13 Glu In Insulin Assembly: The Hexamer Structure Of Recombinant Mutant (B13 Glu-> Gln) Insulin 9823 Sus scrofa gi|443065|pdb|1IZB|C 1IZB_C Chain C, Role Of B13 Glu In Insulin Assembly: The Hexamer Structure Of Recombinant Mutant (B13 Glu-> Gln) Insulin 9823 Sus scrofa gi|494680|pdb|1TRZ|A 1TRZ_A Chain A, Crystallographic Evidence For Dual Coordination Around Zinc In The T3r3 Human Insulin Hexamer 32630 synthetic construct gi|494682|pdb|1TRZ|C 1TRZ_C Chain C, Crystallographic Evidence For Dual Coordination Around Zinc In The T3r3 Human Insulin Hexamer 32630 synthetic construct gi|494929|pdb|7INS|A 7INS_A Chain A, Structure Of Porcine Insulin Cocrystallized With Clupeine Z 9823 Sus scrofa gi|494931|pdb|7INS|C 7INS_C Chain C, Structure Of Porcine Insulin Cocrystallized With Clupeine Z 9823 Sus scrofa gi|494933|pdb|7INS|E 7INS_E Chain E, Structure Of Porcine Insulin Cocrystallized With Clupeine Z 9823 Sus scrofa gi|640458|pdb|1TYL|A 1TYL_A Chain A, The Structure Of A Complex Of Hexameric Insulin And 4'- Hydroxyacetanilide 9606 Homo sapiens gi|640460|pdb|1TYL|C 1TYL_C Chain C, The Structure Of A Complex Of Hexameric Insulin And 4'- Hydroxyacetanilide 9606 Homo sapiens gi|640462|pdb|1TYM|A 1TYM_A Chain A, The Structure Of A Complex Of Hexameric Insulin And 4'- Hydroxyacetanilide 9606 Homo sapiens gi|640464|pdb|1TYM|C 1TYM_C Chain C, The Structure Of A Complex Of Hexameric Insulin And 4'- Hydroxyacetanilide 9606 Homo sapiens gi|1310726|pdb|3MTH|A 3MTH_A Chain A, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310728|pdb|3MTH|C 3MTH_C Chain C, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310730|pdb|2TCI|A 2TCI_A Chain A, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310732|pdb|2TCI|C 2TCI_C Chain C, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310804|pdb|1MPJ|A 1MPJ_A Chain A, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1310806|pdb|1MPJ|C 1MPJ_C Chain C, X-Ray Crystallographic Studies On Hexameric Insulins In The Presence Of Helix-Stabilizing Agents, Thiocyanate, Methylparaben And Phenol 9823 Sus scrofa gi|1633387|pdb|1LPH|A 1LPH_A Chain A, Lys(B28)pro(B29)-Human Insulin 9606 Homo sapiens gi|1633389|pdb|1LPH|C 1LPH_C Chain C, Lys(B28)pro(B29)-Human Insulin 9606 Homo sapiens gi|1942066|pdb|1WAV|A 1WAV_A Chain A, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942068|pdb|1WAV|C 1WAV_C Chain C, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942070|pdb|1WAV|E 1WAV_E Chain E, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942072|pdb|1WAV|G 1WAV_G Chain G, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942074|pdb|1WAV|I 1WAV_I Chain I, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942076|pdb|1WAV|K 1WAV_K Chain K, Crystal Structure Of Form B Monoclinic Crystal Of Insulin 9823 Sus scrofa gi|1942326|pdb|1SDB|A 1SDB_A Chain A, Porcine Desb1-2 Despentapeptide(B26-B30) Insulin 9823 Sus scrofa gi|2392263|pdb|1DEI|A 1DEI_A Chain A, DESHEPTAPEPTIDE (B24-B30) INSULIN 9823 Sus scrofa gi|2392265|pdb|1DEI|C 1DEI_C Chain C, DESHEPTAPEPTIDE (B24-B30) INSULIN 9823 Sus scrofa gi|2392615|pdb|1XDA|A 1XDA_A Chain A, Structure Of Insulin 9606 Homo sapiens gi|2392617|pdb|1XDA|C 1XDA_C Chain C, Structure Of Insulin 9606 Homo sapiens gi|2392619|pdb|1XDA|E 1XDA_E Chain E, Structure Of Insulin 9606 Homo sapiens gi|2392621|pdb|1XDA|G 1XDA_G Chain G, Structure Of Insulin 9606 Homo sapiens gi|2914278|pdb|1ZNI|A 1ZNI_A Chain A, INSULIN 9823 Sus scrofa gi|2914280|pdb|1ZNI|C 1ZNI_C Chain C, INSULIN 9823 Sus scrofa gi|2914282|pdb|1ZNJ|A 1ZNJ_A Chain A, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914284|pdb|1ZNJ|C 1ZNJ_C Chain C, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914286|pdb|1ZNJ|E 1ZNJ_E Chain E, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914288|pdb|1ZNJ|G 1ZNJ_G Chain G, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914290|pdb|1ZNJ|I 1ZNJ_I Chain I, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|2914292|pdb|1ZNJ|K 1ZNJ_K Chain K, Insulin, Monoclinic Crystal Form 9606 Homo sapiens gi|3402131|pdb|1ZEG|A 1ZEG_A Chain A, Structure Of B28 Asp Insulin In Complex With Phenol 9606 Homo sapiens gi|3402133|pdb|1ZEG|C 1ZEG_C Chain C, Structure Of B28 Asp Insulin In Complex With Phenol 9606 Homo sapiens gi|4139762|pdb|1ZEH|A 1ZEH_A Chain A, Structure Of Insulin 9606 Homo sapiens gi|4139764|pdb|1ZEH|C 1ZEH_C Chain C, Structure Of Insulin 9606 Homo sapiens gi|5107539|pdb|1BZV|A 1BZV_A Chain A [D-ALAB26]-DES(B27-B30)-INSULIN-B26-AMIDE A SUPERPOTENT SINGLE-REPLACEMENT INSULIN ANALOGUE, NMR, MINIMIZED AVERAGE STRUCTURE gi|5542372|pdb|1QIY|A 1QIY_A Chain A, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542374|pdb|1QIY|C 1QIY_C Chain C, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542376|pdb|1QIY|E 1QIY_E Chain E, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542378|pdb|1QIY|G 1QIY_G Chain G, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542380|pdb|1QIY|I 1QIY_I Chain I, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542382|pdb|1QIY|K 1QIY_K Chain K, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Phenol 9606 Homo sapiens gi|5542384|pdb|1QIZ|A 1QIZ_A Chain A, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542386|pdb|1QIZ|C 1QIZ_C Chain C, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542388|pdb|1QIZ|E 1QIZ_E Chain E, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542390|pdb|1QIZ|G 1QIZ_G Chain G, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542392|pdb|1QIZ|I 1QIZ_I Chain I, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542394|pdb|1QIZ|K 1QIZ_K Chain K, Human Insulin Hexamers With Chain B His Mutated To Tyr Complexed With Resorcinol 9606 Homo sapiens gi|5542396|pdb|1QJ0|A 1QJ0_A Chain A, Human Insulin Hexamers With Chain B His Mutated To Tyr 9606 Homo sapiens gi|5542398|pdb|1QJ0|C 1QJ0_C Chain C, Human Insulin Hexamers With Chain B His Mutated To Tyr 9606 Homo sapiens gi|6573506|pdb|1B9E|A 1B9E_A Chain A, Human Insulin Mutant Serb9glu 9606 Homo sapiens gi|6573508|pdb|1B9E|C 1B9E_C Chain C, Human Insulin Mutant Serb9glu 9606 Homo sapiens gi|11514586|pdb|1FU2|A 1FU2_A Chain A, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514588|pdb|1FU2|C 1FU2_C Chain C, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514590|pdb|1FU2|E 1FU2_E Chain E, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514592|pdb|1FU2|G 1FU2_G Chain G, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514595|pdb|1FUB|A 1FUB_A Chain A, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|11514597|pdb|1FUB|C 1FUB_C Chain C, First Protein Structure Determined From X-Ray Powder Diffraction Data 32630 synthetic construct gi|12084729|pdb|1EV3|A 1EV3_A Chain A, Structure Of The Rhombohedral Form Of The M-cresol/insulin R6 Hexamer 32630 synthetic construct gi|12084731|pdb|1EV3|C 1EV3_C Chain C, Structure Of The Rhombohedral Form Of The M-cresol/insulin R6 Hexamer 32630 synthetic construct gi|12084733|pdb|1EV6|A 1EV6_A Chain A, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084735|pdb|1EV6|C 1EV6_C Chain C, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084737|pdb|1EV6|E 1EV6_E Chain E, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084739|pdb|1EV6|G 1EV6_G Chain G, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084741|pdb|1EV6|I 1EV6_I Chain I, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084743|pdb|1EV6|K 1EV6_K Chain K, Structure Of The Monoclinic Form Of The M-CresolINSULIN R6 Hexamer 32630 synthetic construct gi|12084749|pdb|1EVR|A 1EVR_A Chain A, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084751|pdb|1EVR|C 1EVR_C Chain C, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084753|pdb|1EVR|E 1EVR_E Chain E, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084755|pdb|1EVR|G 1EVR_G Chain G, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084757|pdb|1EVR|I 1EVR_I Chain I, The Structure Of The Resorcinol/insulin R6 Hexamer gi|12084759|pdb|1EVR|K 1EVR_K Chain K, The Structure Of The Resorcinol/insulin R6 Hexamer gi|14488760|pdb|1HTV|A 1HTV_A Chain A, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488762|pdb|1HTV|C 1HTV_C Chain C, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488764|pdb|1HTV|E 1HTV_E Chain E, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488766|pdb|1HTV|G 1HTV_G Chain G, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488768|pdb|1HTV|I 1HTV_I Chain I, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|14488770|pdb|1HTV|K 1HTV_K Chain K, Crystal Structure Of Destripeptide (B28-B30) Insulin 9606 Homo sapiens gi|20149923|pdb|1GUJ|A 1GUJ_A Chain A, Insulin At Ph 2: Structural Analysis Of The Conditions Promoting Insulin Fibre Formation. 9606 Homo sapiens gi|20149925|pdb|1GUJ|C 1GUJ_C Chain C, Insulin At Ph 2: Structural Analysis Of The Conditions Promoting Insulin Fibre Formation. 9606 Homo sapiens gi|23200470|pdb|1M5A|A 1M5A_A Chain A, Crystal Structure Of 2-co(2+)-insulin At 1.2a Resolution 9823 Sus scrofa gi|23200472|pdb|1M5A|C 1M5A_C Chain C, Crystal Structure Of 2-co(2+)-insulin At 1.2a Resolution 9823 Sus scrofa gi|30749213|pdb|1B17|A 1B17_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 5.00 Coordinates) 9823 Sus scrofa gi|30749215|pdb|1B18|A 1B18_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 5.53 Coordinates) 9823 Sus scrofa gi|30749217|pdb|1B19|A 1B19_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 5.80 Coordinates) 9823 Sus scrofa gi|30749219|pdb|1B2A|A 1B2A_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.00 Coordinates) 9823 Sus scrofa gi|30749221|pdb|1B2B|A 1B2B_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.16 Coordinates) 9823 Sus scrofa gi|30749223|pdb|1B2C|A 1B2C_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.26 Coordinates) 9823 Sus scrofa gi|30749225|pdb|1B2D|A 1B2D_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.35 Coordinates) 9823 Sus scrofa gi|30749227|pdb|1B2E|A 1B2E_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.50 Coordinates) 9823 Sus scrofa gi|30749229|pdb|1B2F|A 1B2F_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 6.98 Coordinates) 9823 Sus scrofa gi|30749231|pdb|1B2G|A 1B2G_A Chain A, Ph Affects Glu B13 Switching And Sulfate Binding In Cubic Insulin Crystals (Ph 9.00 Coordinates) 9823 Sus scrofa gi|34811012|pdb|1OS3|A 1OS3_A Chain A, Dehydrated T6 Human Insulin At 100 K 9606 Homo sapiens gi|34811014|pdb|1OS3|C 1OS3_C Chain C, Dehydrated T6 Human Insulin At 100 K 9606 Homo sapiens gi|34811016|pdb|1OS4|A 1OS4_A Chain A, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811018|pdb|1OS4|C 1OS4_C Chain C, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811020|pdb|1OS4|E 1OS4_E Chain E, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811022|pdb|1OS4|G 1OS4_G Chain G, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811024|pdb|1OS4|I 1OS4_I Chain I, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|34811026|pdb|1OS4|K 1OS4_K Chain K, Dehydrated T6 Human Insulin At 295 K 9606 Homo sapiens gi|61680181|pdb|1W8P|A 1W8P_A Chain A, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680183|pdb|1W8P|C 1W8P_C Chain C, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680185|pdb|1W8P|E 1W8P_E Chain E, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680187|pdb|1W8P|G 1W8P_G Chain G, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680189|pdb|1W8P|I 1W8P_I Chain I, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|61680191|pdb|1W8P|K 1W8P_K Chain K, Structural Properties Of The B25tyr-nme-b26phe Insulin Mutant. 9606 Homo sapiens gi|62738082|pdb|1UZ9|A 1UZ9_A Chain A, Crystallographic And Solution Studies Of N-Lithocholyl Insulin: A New Generation Of Prolonged-Acting Insulins. 9606 Homo sapiens gi|93278993|pdb|2C8Q|A 2C8Q_A Chain A, Insuline(1sec) And Uv Laser Excited Fluorescence 9606 Homo sapiens gi|93278995|pdb|2C8R|A 2C8R_A Chain A, Insuline(60sec) And Uv Laser Excited Fluorescence 9606 Homo sapiens gi|93279098|pdb|2CEU|A 2CEU_A Chain A, Despentapeptide Insulin In Acetic Acid (Ph 2) 9606 Homo sapiens gi|93279100|pdb|2CEU|C 2CEU_C Chain C, Despentapeptide Insulin In Acetic Acid (Ph 2) 9606 Homo sapiens gi|134104329|pdb|2G4M|A 2G4M_A Chain A, Insulin Collected At 2.0 A Wavelength 9823 Sus scrofa gi|145580082|pdb|2OMG|A 2OMG_A Chain A, Structure of human insulin cocrystallized with protamine and urea 9606 Homo sapiens gi|145580084|pdb|2OMG|C 2OMG_C Chain C, Structure of human insulin cocrystallized with protamine and urea 9606 Homo sapiens gi|145580086|pdb|2OMG|E 2OMG_E Chain E, Structure of human insulin cocrystallized with protamine and urea 9606 Homo sapiens gi|145580088|pdb|2OMH|A 2OMH_A Chain A, Structure of human insulin cocrystallized with ARG-12 peptide in presence of urea 9606 Homo sapiens gi|145580090|pdb|2OMH|C 2OMH_C Chain C, Structure of human insulin cocrystallized with ARG-12 peptide in presence of urea 9606 Homo sapiens gi|145580092|pdb|2OMH|E 2OMH_E Chain E, Structure of human insulin cocrystallized with ARG-12 peptide in presence of urea 9606 Homo sapiens gi|145580094|pdb|2OMI|A 2OMI_A Chain A, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580096|pdb|2OMI|C 2OMI_C Chain C, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580098|pdb|2OMI|E 2OMI_E Chain E, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580100|pdb|2OMI|G 2OMI_G Chain G, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580102|pdb|2OMI|I 2OMI_I Chain I, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|145580104|pdb|2OMI|K 2OMI_K Chain K, Structure Of Human Insulin Cocrystallized With Protamine 9606 Homo sapiens gi|159162031|pdb|1A7F|A 1A7F_A Chain A, Insulin Mutant B16 Glu, B24 Gly, Des-B30, Nmr, 20 Structures 9606 Homo sapiens gi|159162047|pdb|1AI0|A 1AI0_A Chain A, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162049|pdb|1AI0|C 1AI0_C Chain C, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162051|pdb|1AI0|E 1AI0_E Chain E, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162053|pdb|1AI0|G 1AI0_G Chain G, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162055|pdb|1AI0|I 1AI0_I Chain I, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162057|pdb|1AI0|K 1AI0_K Chain K, R6 Human Insulin Hexamer (Non-Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162059|pdb|1AIY|A 1AIY_A Chain A, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162061|pdb|1AIY|C 1AIY_C Chain C, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162063|pdb|1AIY|E 1AIY_E Chain E, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162065|pdb|1AIY|G 1AIY_G Chain G, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162067|pdb|1AIY|I 1AIY_I Chain I, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162069|pdb|1AIY|K 1AIY_K Chain K, R6 Human Insulin Hexamer (Symmetric), Nmr, 10 Structures 9606 Homo sapiens gi|159162400|pdb|1HIQ|A 1HIQ_A Chain A, PARADOXICAL STRUCTURE AND FUNCTION IN A MUTANT HUMAN INSULIN ASSOCIATED WITH DIABETES MELLITUS 9606 Homo sapiens gi|159162402|pdb|1HIS|A 1HIS_A Chain A, Structure And Dynamics Of Des-Pentapeptide-Insulin In Solution: The Molten-Globule Hypothesis. 9606 Homo sapiens gi|159162404|pdb|1HIT|A 1HIT_A Chain A, Receptor Binding Redefined By A Structural Switch In A Mutant Human Insulin 9606 Homo sapiens gi|159162411|pdb|1HLS|A 1HLS_A Chain A, NMR STRUCTURE OF THE HUMAN INSULIN-HIS(B16) 9606 Homo sapiens gi|159162439|pdb|1HUI|A 1HUI_A Chain A, INSULIN MUTANT (B1, B10, B16, B27)GLU, DES-B30, NMR, 25 STRUCTURES 9606 Homo sapiens gi|159162547|pdb|1JCO|A 1JCO_A Chain A, Solution Structure Of The Monomeric [thr(B27)->pro,Pro(B28)- >thr] Insulin Mutant (Pt Insulin) 9606 Homo sapiens gi|159162693|pdb|1MHJ|A 1MHJ_A Chain A, SOLUTION STRUCTURE OF THE SUPERACTIVE MONOMERIC DES-[PHE(B25)] HUMAN INSULIN MUTANT. ELUCIDATION OF THE STRUCTURAL BASIS FOR THE MONOMERIZATION OF THE DES-[PHE(B25)] INSULIN AND THE DIMERIZATION OF NATIVE INSULIN 9606 Homo sapiens gi|159163010|pdb|1SF1|A 1SF1_A Chain A, NMR STRUCTURE OF HUMAN INSULIN under Amyloidogenic Condition, 15 STRUCTURES 9606 Homo sapiens gi|159163012|pdb|1SJT|A 1SJT_A Chain A, Mini-Proinsulin, Two Chain Insulin Analog Mutant: Des B30, His(B 10)asp, Pro(B 28)asp, Nmr, 20 Structures 9606 Homo sapiens gi|159163035|pdb|1T1K|A 1T1K_A Chain A, NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-ALA, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES gi|159163037|pdb|1T1P|A 1T1P_A Chain A, NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-THR, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES gi|159163039|pdb|1T1Q|A 1T1Q_A Chain A, NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-ABA, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES gi|159163611|pdb|1XGL|A 1XGL_A Chain A, Human Insulin Disulfide Isomer, Nmr, 10 Structures 9606 Homo sapiens gi|159163729|pdb|2AIY|A 2AIY_A Chain A, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163731|pdb|2AIY|C 2AIY_C Chain C, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163733|pdb|2AIY|E 2AIY_E Chain E, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163735|pdb|2AIY|G 2AIY_G Chain G, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163737|pdb|2AIY|I 2AIY_I Chain I, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159163739|pdb|2AIY|K 2AIY_K Chain K, R6 Human Insulin Hexamer (Symmetric), Nmr, 20 Structures 32630 synthetic construct gi|159164618|pdb|2H67|A 2H67_A Chain A, NMR structure of human insulin mutant HIS-B5-ALA, HIS-B10-ASP PRO-B28-LYS, LYS-B29-PRO, 20 structures 9606 Homo sapiens gi|159164629|pdb|2HH4|A 2HH4_A Chain A, NMR structure of human insulin mutant GLY-B8-D-SER, HIS-B10-ASP PRO-B28-LYS, LYS-B29-PRO, 20 structures 9606 Homo sapiens gi|159164630|pdb|2HHO|A 2HHO_A Chain A, NMR structure of human insulin mutant GLY-B8-SER, HIS-B10-ASP PRO-B28-LYS, LYS-B29-PRO, 20 structures 9606 Homo sapiens gi|159164632|pdb|2HIU|A 2HIU_A Chain A, NMR STRUCTURE OF HUMAN INSULIN IN 20% ACETIC ACID, ZINC-FREE, 10 STRUCTURES 9606 Homo sapiens gi|159164700|pdb|2JMN|A 2JMN_A Chain A, NMR structure of human insulin mutant His-B10-Asp, Pro-B28-Lys, Lys-B29-Pro, 20 structures 9606 Homo sapiens gi|159164857|pdb|3AIY|A 3AIY_A Chain A, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164859|pdb|3AIY|C 3AIY_C Chain C, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164861|pdb|3AIY|E 3AIY_E Chain E, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164863|pdb|3AIY|G 3AIY_G Chain G, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164865|pdb|3AIY|I 3AIY_I Chain I, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164867|pdb|3AIY|K 3AIY_K Chain K, R6 Human Insulin Hexamer (Symmetric), Nmr, Refined Average Structure 32630 synthetic construct gi|159164882|pdb|4AIY|A 4AIY_A Chain A, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164884|pdb|4AIY|C 4AIY_C Chain C, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164886|pdb|4AIY|E 4AIY_E Chain E, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164888|pdb|4AIY|G 4AIY_G Chain G, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164890|pdb|4AIY|I 4AIY_I Chain I, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164892|pdb|4AIY|K 4AIY_K Chain K, R6 Human Insulin Hexamer (Symmetric), Nmr, 'green' Substate, Average Structure 32630 synthetic construct gi|159164895|pdb|5AIY|A 5AIY_A Chain A, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164897|pdb|5AIY|C 5AIY_C Chain C, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164899|pdb|5AIY|E 5AIY_E Chain E, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164901|pdb|5AIY|G 5AIY_G Chain G, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164903|pdb|5AIY|I 5AIY_I Chain I, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|159164905|pdb|5AIY|K 5AIY_K Chain K, R6 Human Insulin Hexamer (Symmetric), Nmr, 'red' Substate, Average Structure 32630 synthetic construct gi|161760927|pdb|2OLY|A 2OLY_A Chain A, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760929|pdb|2OLY|C 2OLY_C Chain C, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760931|pdb|2OLY|E 2OLY_E Chain E, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760933|pdb|2OLY|G 2OLY_G Chain G, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760935|pdb|2OLY|I 2OLY_I Chain I, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760937|pdb|2OLY|K 2OLY_K Chain K, Structure of human insulin in presence of urea at pH 7.0 9606 Homo sapiens gi|161760939|pdb|2OLZ|A 2OLZ_A Chain A, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760941|pdb|2OLZ|C 2OLZ_C Chain C, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760943|pdb|2OLZ|E 2OLZ_E Chain E, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760945|pdb|2OLZ|G 2OLZ_G Chain G, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760947|pdb|2OLZ|I 2OLZ_I Chain I, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760949|pdb|2OLZ|K 2OLZ_K Chain K, Structure of human insulin in presence of thiocyanate at pH 7.0 9606 Homo sapiens gi|161760951|pdb|2OM0|A 2OM0_A Chain A, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760953|pdb|2OM0|C 2OM0_C Chain C, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760955|pdb|2OM0|E 2OM0_E Chain E, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760957|pdb|2OM0|G 2OM0_G Chain G, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760959|pdb|2OM0|I 2OM0_I Chain I, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760961|pdb|2OM0|K 2OM0_K Chain K, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760963|pdb|2OM0|Q 2OM0_Q Chain Q, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760965|pdb|2OM0|S 2OM0_S Chain S, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760967|pdb|2OM0|U 2OM0_U Chain U, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760969|pdb|2OM0|X 2OM0_X Chain X, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760971|pdb|2OM0|1 2OM0_1 Chain 1, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760973|pdb|2OM0|3 2OM0_3 Chain 3, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760975|pdb|2OM0|AA 2OM0_AA Chain a, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760977|pdb|2OM0|CC 2OM0_CC Chain c, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760979|pdb|2OM0|EE 2OM0_EE Chain e, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760981|pdb|2OM0|GG 2OM0_GG Chain g, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760983|pdb|2OM0|II 2OM0_II Chain i, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760985|pdb|2OM0|KK 2OM0_KK Chain k, Structure of human insulin in presence of urea at pH 6.5 9606 Homo sapiens gi|161760987|pdb|2OM1|A 2OM1_A Chain A, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760989|pdb|2OM1|C 2OM1_C Chain C, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760991|pdb|2OM1|E 2OM1_E Chain E, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760993|pdb|2OM1|G 2OM1_G Chain G, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760995|pdb|2OM1|I 2OM1_I Chain I, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760997|pdb|2OM1|K 2OM1_K Chain K, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161760999|pdb|2OM1|Q 2OM1_Q Chain Q, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761001|pdb|2OM1|S 2OM1_S Chain S, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761003|pdb|2OM1|U 2OM1_U Chain U, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761005|pdb|2OM1|X 2OM1_X Chain X, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761007|pdb|2OM1|1 2OM1_1 Chain 1, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761009|pdb|2OM1|3 2OM1_3 Chain 3, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761011|pdb|2OM1|AA 2OM1_AA Chain a, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761013|pdb|2OM1|CC 2OM1_CC Chain c, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761015|pdb|2OM1|EE 2OM1_EE Chain e, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761017|pdb|2OM1|GG 2OM1_GG Chain g, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761019|pdb|2OM1|II 2OM1_II Chain i, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|161761021|pdb|2OM1|KK 2OM1_KK Chain k, Structure of human insulin in presence of thiocyanate at pH 6.5 9606 Homo sapiens gi|162329911|pdb|2JV1|A 2JV1_A Chain A, NMR structure of human insulin monomer in 35% CD3CN zinc free, 50 structures 9606 Homo sapiens gi|188595955|pdb|3BXQ|A 3BXQ_A Chain A, The Structure Of A Mutant Insulin Uncouples Receptor Binding From Protein Allostery. An Electrostatic Block To The Tr Transition 32630 synthetic construct gi|188595957|pdb|3BXQ|C 3BXQ_C Chain C, The Structure Of A Mutant Insulin Uncouples Receptor Binding From Protein Allostery. An Electrostatic Block To The Tr Transition 32630 synthetic construct gi|203282269|pdb|2VJZ|A 2VJZ_A Chain A, Crystal Structure Form Ultalente Insulin Microcrystals 9606 Homo sapiens gi|203282271|pdb|2VJZ|C 2VJZ_C Chain C, Crystal Structure Form Ultalente Insulin Microcrystals 9606 Homo sapiens gi|203282273|pdb|2VK0|A 2VK0_A Chain A, Crystal Structure Form Ultalente Insulin Microcrystals 9606 Homo sapiens gi|203282275|pdb|2VK0|C 2VK0_C Chain C, Crystal Structure Form Ultalente Insulin Microcrystals 9606 Homo sapiens gi|210060770|pdb|2RN5|A 2RN5_A Chain A, Humal Insulin Mutant B31Lys-B32Arg 9606 Homo sapiens gi|212374854|pdb|2K9R|A 2K9R_A Chain A, Enhancing the activity of insulin by stereospecific unfolding 9606 Homo sapiens gi|213424021|pdb|2K91|A 2K91_A Chain A, Enhancing the activity of insulin by stereospecific unfolding 9606 Homo sapiens gi|224036336|pdb|3E7Y|A 3E7Y_A Chain A, Structure Of Human Insulin 9606 Homo sapiens gi|224036338|pdb|3E7Y|C 3E7Y_C Chain C, Structure Of Human Insulin 9606 Homo sapiens gi|224036340|pdb|3E7Z|A 3E7Z_A Chain A, Structure Of Human Insulin 9606 Homo sapiens gi|224036342|pdb|3E7Z|C 3E7Z_C Chain C, Structure Of Human Insulin 9606 Homo sapiens gi|225733951|pdb|2WC0|C 2WC0_C Chain C, Crystal Structure Of Human Insulin Degrading Enzyme In Complex With Iodinated Insulin 32630 synthetic construct gi|225733953|pdb|2WC0|E 2WC0_E Chain E, Crystal Structure Of Human Insulin Degrading Enzyme In Complex With Iodinated Insulin 32630 synthetic construct gi|237823823|pdb|3EXX|A 3EXX_A Chain A, Structure Of The T6 Human Insulin Derivative With Nickel At 1.35 A Resolution 9606 Homo sapiens gi|237823825|pdb|3EXX|C 3EXX_C Chain C, Structure Of The T6 Human Insulin Derivative With Nickel At 1.35 A Resolution 9606 Homo sapiens gi|283135363|pdb|3I3Z|A 3I3Z_A Chain A, Human Insulin 9606 Homo sapiens gi|283135365|pdb|3I40|A 3I40_A Chain A, Human Insulin 9606 Homo sapiens gi|288562780|pdb|2WRU|A 2WRU_A Chain A, Semi-synthetic Highly Active Analogue Of Human Insulin Nmealab26-dti-nh2 9606 Homo sapiens gi|288562782|pdb|2WRV|A 2WRV_A Chain A, Semi-synthetic Highly Active Analogue Of Human Insulin Nmehisb26-dti- Nh2 9606 Homo sapiens gi|288562784|pdb|2WRW|A 2WRW_A Chain A, Semi-Synthetic Highly Active Analogue Of Human Insulin D- Prob26-Dti-Nh2 9606 Homo sapiens gi|288562786|pdb|2WRX|A 2WRX_A Chain A, Semi-Synthetic Analogue Of Human Insulin Nmealab26-Insulin At Ph 3.0 9606 Homo sapiens gi|288562788|pdb|2WRX|C 2WRX_C Chain C, Semi-Synthetic Analogue Of Human Insulin Nmealab26-Insulin At Ph 3.0 9606 Homo sapiens gi|288562790|pdb|2WS0|A 2WS0_A Chain A, Semi-Synthetic Analogue Of Human Insulin Nmealab26-Insulin At Ph 7.5 9606 Homo sapiens gi|288562792|pdb|2WS1|A 2WS1_A Chain A, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Monomer Form 9606 Homo sapiens gi|288562794|pdb|2WS4|A 2WS4_A Chain A, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti In Monomer Form 9606 Homo sapiens gi|288562796|pdb|2WS6|A 2WS6_A Chain A, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562798|pdb|2WS6|C 2WS6_C Chain C, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562800|pdb|2WS6|E 2WS6_E Chain E, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562802|pdb|2WS6|G 2WS6_G Chain G, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562804|pdb|2WS6|I 2WS6_I Chain I, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562806|pdb|2WS6|K 2WS6_K Chain K, Semi-Synthetic Analogue Of Human Insulin Nmetyrb26-Insulin In Hexamer Form 9606 Homo sapiens gi|288562808|pdb|2WS7|A 2WS7_A Chain A, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562810|pdb|2WS7|C 2WS7_C Chain C, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562812|pdb|2WS7|E 2WS7_E Chain E, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562814|pdb|2WS7|G 2WS7_G Chain G, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562816|pdb|2WS7|I 2WS7_I Chain I, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|288562818|pdb|2WS7|K 2WS7_K Chain K, Semi-Synthetic Analogue Of Human Insulin Prob26-Dti 9606 Homo sapiens gi|298508256|pdb|2KJJ|A 2KJJ_A Chain A, Dynamics of insulin probed by 1H-NMR amide proton exchange anomalous flexibility of the receptor-binding surface 9606 Homo sapiens gi|298508258|pdb|2KJU|A 2KJU_A Chain A, NMR structure of human insulin mutant glu-b21-d-glu, his-b10 asp pro-b28-lys, lys-b29-pro, 20 structures 9606 Homo sapiens gi|302566077|pdb|3ILG|A 3ILG_A Chain A, Crystal Structure Of Humnan Insulin Sr+2 Complex 9606 Homo sapiens gi|302566079|pdb|3ILG|C 3ILG_C Chain C, Crystal Structure Of Humnan Insulin Sr+2 Complex 9606 Homo sapiens gi|303324847|pdb|3INC|A 3INC_A Chain A, Crystal Structure Of Human Insulin With Ni+2 Complex 9606 Homo sapiens gi|303324849|pdb|3INC|C 3INC_C Chain C, Crystal Structure Of Human Insulin With Ni+2 Complex 9606 Homo sapiens gi|305677676|pdb|3IR0|A 3IR0_A Chain A, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677678|pdb|3IR0|C 3IR0_C Chain C, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677680|pdb|3IR0|E 3IR0_E Chain E, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677682|pdb|3IR0|G 3IR0_G Chain G, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677684|pdb|3IR0|I 3IR0_I Chain I, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677686|pdb|3IR0|K 3IR0_K Chain K, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677688|pdb|3IR0|M 3IR0_M Chain M, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677690|pdb|3IR0|O 3IR0_O Chain O, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677692|pdb|3IR0|R 3IR0_R Chain R, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677694|pdb|3IR0|T 3IR0_T Chain T, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677696|pdb|3IR0|V 3IR0_V Chain V, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|305677698|pdb|3IR0|X 3IR0_X Chain X, Crystal Structure Of Human Insulin Complexed With Cu+2 Metal Ion 9606 Homo sapiens gi|306991612|pdb|3JSD|A 3JSD_A Chain A, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|306991614|pdb|3JSD|C 3JSD_C Chain C, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|312597012|pdb|2KQQ|A 2KQQ_A Chain A, NMR structure of human insulin mutant gly-b8-d-ala, his-b10-asp, pro-b28-lys, lys-b29-pro, 20 structures 9606 Homo sapiens gi|329666184|pdb|3Q6E|A 3Q6E_A Chain A, Human Insulin In Complex With Cucurbit[7]uril 9606 Homo sapiens gi|329666186|pdb|3Q6E|C 3Q6E_C Chain C, Human Insulin In Complex With Cucurbit[7]uril 9606 Homo sapiens gi|333361518|pdb|3RTO|A 3RTO_A Chain A, Acoustically Mounted Porcine Insulin Microcrystals Yield An X-Ray Sad Structure 9823 Sus scrofa gi|333361520|pdb|3RTO|C 3RTO_C Chain C, Acoustically Mounted Porcine Insulin Microcrystals Yield An X-Ray Sad Structure 9823 Sus scrofa gi|342351234|pdb|3ZU1|A 3ZU1_A Chain A, Structure of LysB29(Nepsilon omega-carboxyheptadecanoyl) des(B30) Human Insulin 9606 Homo sapiens gi|342351236|pdb|3ZU1|C 3ZU1_C Chain C, Structure of LysB29(Nepsilon omega-carboxyheptadecanoyl) des(B30) Human Insulin 9606 Homo sapiens gi|344189904|pdb|3ZQR|A 3ZQR_A Chain A, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189906|pdb|3ZQR|C 3ZQR_C Chain C, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189908|pdb|3ZQR|E 3ZQR_E Chain E, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189910|pdb|3ZQR|G 3ZQR_G Chain G, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189912|pdb|3ZQR|I 3ZQR_I Chain I, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|344189914|pdb|3ZQR|K 3ZQR_K Chain K, Nmepheb25 Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345110694|pdb|2L1Y|A 2L1Y_A Chain A, NMR Structure of human insulin mutant GLY-B20-D-ALA, GLY-B23-D-ALA PRO-B28-LYS, LYS-B29-PRO, 20 Structures 9606 Homo sapiens gi|345111088|pdb|3ZS2|A 3ZS2_A Chain A, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111090|pdb|3ZS2|C 3ZS2_C Chain C, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111092|pdb|3ZS2|E 3ZS2_E Chain E, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111094|pdb|3ZS2|G 3ZS2_G Chain G, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111096|pdb|3ZS2|I 3ZS2_I Chain I, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|345111098|pdb|3ZS2|K 3ZS2_K Chain K, Tyrb25,Nmepheb26,Lysb28,Prob29-Insulin Analogue Crystal Structure 9606 Homo sapiens gi|353251896|pdb|3TT8|A 3TT8_A Chain A, Crystal Structure Analysis Of Cu Human Insulin Derivative 9606 Homo sapiens gi|353251898|pdb|3TT8|C 3TT8_C Chain C, Crystal Structure Analysis Of Cu Human Insulin Derivative 9606 Homo sapiens gi|353529982|pdb|2EFA|A 2EFA_A Chain A, Neutron crystal structure of cubic insulin at pD6.6 9823 Sus scrofa gi|353529985|pdb|2ZPP|A 2ZPP_A Chain A, Neutron crystal structure of cubic insulin at pD9 9823 Sus scrofa gi|353529989|pdb|3FHP|A 3FHP_A Chain A, A neutron crystallographic analysis of a porcine 2Zn insulin at 2.0 A resolution 9823 Sus scrofa gi|353529991|pdb|3FHP|C 3FHP_C Chain C, A neutron crystallographic analysis of a porcine 2Zn insulin at 2.0 A resolution 9823 Sus scrofa gi|357380865|pdb|1G7A|A 1G7A_A Chain A, 1.2 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|357380867|pdb|1G7A|C 1G7A_C Chain C, 1.2 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|357380869|pdb|1G7A|E 1G7A_E Chain E, 1.2 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|357380871|pdb|1G7A|G 1G7A_G Chain G, 1.2 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|358009476|pdb|3P2X|A 3P2X_A Chain A, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiaral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009478|pdb|3P2X|C 3P2X_C Chain C, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiaral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009480|pdb|3P33|A 3P33_A Chain A, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009482|pdb|3P33|C 3P33_C Chain C, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009484|pdb|3P33|E 3P33_E Chain E, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358009486|pdb|3P33|G 3P33_G Chain G, Insulin Fibrillation Is The Janus Face Of Induced Fit. A Chiral Clamp Stabilizes The Native State At The Expense Of Activity 9606 Homo sapiens gi|358440268|pdb|4A7E|A 4A7E_A Chain A, X-Ray Crystal Structure Of Porcine Insulin Flash-Cooled At High Pressure 9823 Sus scrofa gi|365813086|pdb|3T2A|A 3T2A_A Chain A, Tmao-Grown Cubic Insulin (Porcine) 9823 Sus scrofa gi|383875504|pdb|3U4N|A 3U4N_A Chain A, A Novel Covalently Linked Insulin Dimer 9606 Homo sapiens gi|385867322|pdb|3ROV|A 3ROV_A Chain A, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867324|pdb|3ROV|C 3ROV_C Chain C, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867326|pdb|3ROV|E 3ROV_E Chain E, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867328|pdb|3ROV|G 3ROV_G Chain G, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867330|pdb|3ROV|I 3ROV_I Chain I, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|385867332|pdb|3ROV|K 3ROV_K Chain K, Insulin's biosynthesis and activity have opposing structural requirements: a new factor in neonatal diabetes mellitus gi|407280301|pdb|1G7B|A 1G7B_A Chain A, 1.3 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|407280303|pdb|1G7B|C 1G7B_C Chain C, 1.3 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|407280305|pdb|1G7B|E 1G7B_E Chain E, 1.3 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|407280307|pdb|1G7B|G 1G7B_G Chain G, 1.3 A Structure Of T3r3 Human Insulin At 100 K 32630 synthetic construct gi|429544231|pdb|3V1G|A 3V1G_A Chain A, Forestalling Insulin Fibrillation By Insertion Of A Chiral Clamp Mechanism-based Application Of Protein Engineering To Global Health 9606 Homo sapiens gi|429544233|pdb|3V1G|C 3V1G_C Chain C, Forestalling Insulin Fibrillation By Insertion Of A Chiral Clamp Mechanism-based Application Of Protein Engineering To Global Health 9606 Homo sapiens gi|440690582|pdb|3W11|A 3W11_A Chain A, Insulin Receptor Ectodomain Construct Comprising Domains L1-cr In Complex With Human Insulin, Alpha-ct Peptide(704-719) And Fab 83-7 9606 Homo sapiens gi|440690591|pdb|3W12|A 3W12_A Chain A, Insulin Receptor Ectodomain Construct Comprising Domains L1-cr In Complex With High-affinity Insulin Analogue [d-pro-b26]-dti-nh2, Alpha-ct Peptide(704-719) And Fab 83-7 9606 Homo sapiens gi|440690598|pdb|3W13|A 3W13_A Chain A, Insulin Receptor Ectodomain Construct Comprising Domains L1-cr In Complex With High-affinity Insulin Analogue [d-pro-b26]-dti-nh2, Alphact Peptide(693-719) And Fab 83-7 9606 Homo sapiens gi|440690681|pdb|4AJX|A 4AJX_A Chain A, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690683|pdb|4AJX|C 4AJX_C Chain C, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690685|pdb|4AJX|E 4AJX_E Chain E, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690687|pdb|4AJX|G 4AJX_G Chain G, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690689|pdb|4AJX|I 4AJX_I Chain I, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690691|pdb|4AJX|K 4AJX_K Chain K, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690693|pdb|4AJZ|A 4AJZ_A Chain A, Ligand controlled assembly of hexamers, dihexamers, and linear multihexamer structures by an engineered acylated insulin 9606 Homo sapiens gi|440690695|pdb|4AJZ|C 4AJZ_C Chain C, Ligand controlled assembly of hexamers, dihexamers, and linear multihexamer structures by an engineered acylated insulin 9606 Homo sapiens gi|440690697|pdb|4AK0|A 4AK0_A Chain A, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690699|pdb|4AKJ|A 4AKJ_A Chain A, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440690701|pdb|4AKJ|C 4AKJ_C Chain C, Ligand Controlled Assembly Of Hexamers, Dihexamers, And Linear Multihexamer Structures By An Engineered Acylated Insulin 9606 Homo sapiens gi|440923775|pdb|1MSO|A 1MSO_A Chain A, T6 Human Insulin At 1.0 A Resolution gi|440923777|pdb|1MSO|C 1MSO_C Chain C, T6 Human Insulin At 1.0 A Resolution gi|449802480|pdb|4FKA|A 4FKA_A Chain A, High Resolution Structure Of The Manganese Derivative Of Insulin 9606 Homo sapiens gi|449802482|pdb|4FKA|C 4FKA_C Chain C, High Resolution Structure Of The Manganese Derivative Of Insulin 9606 Homo sapiens gi|449802758|pdb|4IUZ|A 4IUZ_A Chain A, High Resolution Crystal Structure Of Racemic Ester Insulin 9606 Homo sapiens gi|453055535|pdb|2M1D|A 2M1D_A Chain A, Biosynthetic engineered B28K-B29P human insulin monomer structure in in water/acetonitrile solutions. 9606 Homo sapiens gi|453055537|pdb|2M1E|A 2M1E_A Chain A, Biosynthetic engineered B28K-B29P human insulin monomer structure in in water solutions. 9606 Homo sapiens gi|459358285|pdb|2M2M|A 2M2M_A Chain A, Structure of [L-HisB24] insulin analogue at pH 1.9 gi|459358287|pdb|2M2N|A 2M2N_A Chain A, Structure of [L-HisB24] insulin analogue at pH 8.0 gi|459358289|pdb|2M2O|A 2M2O_A Chain A, Structure of [D-HisB24] insulin analogue at pH 1.9 gi|459358291|pdb|2M2P|A 2M2P_A Chain A, Structure of [D-HisB24] insulin analogue at pH 8.0 gi|459358427|pdb|3ZI3|A 3ZI3_A Chain A, Crystal Structure Of The B24his-insulin - Human Analogue 9606 Homo sapiens gi|485601704|pdb|4EWW|A 4EWW_A Chain A, Human Insulin 9606 Homo sapiens gi|485601706|pdb|4EWW|C 4EWW_C Chain C, Human Insulin 9606 Homo sapiens gi|485601708|pdb|4EWX|A 4EWX_A Chain A, Human Insulin 9606 Homo sapiens gi|485601710|pdb|4EWX|C 4EWX_C Chain C, Human Insulin 9606 Homo sapiens gi|485601712|pdb|4EWZ|A 4EWZ_A Chain A, Human Insulin 9606 Homo sapiens gi|485601714|pdb|4EWZ|C 4EWZ_C Chain C, Human Insulin 9606 Homo sapiens gi|485601716|pdb|4EX0|A 4EX0_A Chain A, Human Insulin 9606 Homo sapiens gi|485601718|pdb|4EX0|C 4EX0_C Chain C, Human Insulin 9606 Homo sapiens gi|485601720|pdb|4EX1|A 4EX1_A Chain A, Human Insulin 9606 Homo sapiens gi|485601722|pdb|4EX1|C 4EX1_C Chain C, Human Insulin 9606 Homo sapiens gi|485601724|pdb|4EXX|A 4EXX_A Chain A, Human Insulin 9606 Homo sapiens gi|485601726|pdb|4EXX|C 4EXX_C Chain C, Human Insulin 9606 Homo sapiens gi|485601728|pdb|4EY1|A 4EY1_A Chain A, Human Insulin 9606 Homo sapiens gi|485601730|pdb|4EY1|C 4EY1_C Chain C, Human Insulin 9606 Homo sapiens gi|485601732|pdb|4EY9|A 4EY9_A Chain A, Human Insulin 9606 Homo sapiens gi|485601734|pdb|4EY9|C 4EY9_C Chain C, Human Insulin 9606 Homo sapiens gi|485601736|pdb|4EYD|A 4EYD_A Chain A, Human Insulin 9606 Homo sapiens gi|485601738|pdb|4EYD|C 4EYD_C Chain C, Human Insulin 9606 Homo sapiens gi|485601740|pdb|4EYN|A 4EYN_A Chain A, Human Insulin 9606 Homo sapiens gi|485601742|pdb|4EYN|C 4EYN_C Chain C, Human Insulin 9606 Homo sapiens gi|485601744|pdb|4EYP|A 4EYP_A Chain A, Human Insulin 9606 Homo sapiens gi|485601746|pdb|4EYP|C 4EYP_C Chain C, Human Insulin 9606 Homo sapiens gi|491668281|pdb|4F0N|A 4F0N_A Chain A, Human Insulin 9606 Homo sapiens gi|491668283|pdb|4F0N|C 4F0N_C Chain C, Human Insulin 9606 Homo sapiens gi|491668285|pdb|4F0O|A 4F0O_A Chain A, Human Insulin 9606 Homo sapiens gi|491668287|pdb|4F0O|C 4F0O_C Chain C, Human Insulin 9606 Homo sapiens gi|491668291|pdb|4F1A|A 4F1A_A Chain A, Human Insulin 9606 Homo sapiens gi|491668293|pdb|4F1A|C 4F1A_C Chain C, Human Insulin 9606 Homo sapiens gi|491668295|pdb|4F1B|A 4F1B_A Chain A, Human Insulin 9606 Homo sapiens gi|491668297|pdb|4F1B|C 4F1B_C Chain C, Human Insulin 9606 Homo sapiens gi|491668299|pdb|4F1C|A 4F1C_A Chain A, Human Insulin 9606 Homo sapiens gi|491668301|pdb|4F1C|C 4F1C_C Chain C, Human Insulin 9606 Homo sapiens gi|491668303|pdb|4F1D|A 4F1D_A Chain A, Human Insulin 9606 Homo sapiens gi|491668305|pdb|4F1D|C 4F1D_C Chain C, Human Insulin 9606 Homo sapiens gi|491668307|pdb|4F1F|A 4F1F_A Chain A, Human Insulin 9606 Homo sapiens gi|491668309|pdb|4F1F|C 4F1F_C Chain C, Human Insulin 9606 Homo sapiens gi|491668311|pdb|4F1G|A 4F1G_A Chain A, Human Insulin 9606 Homo sapiens gi|491668313|pdb|4F1G|C 4F1G_C Chain C, Human Insulin 9606 Homo sapiens gi|499141950|pdb|4F4T|A 4F4T_A Chain A, Human Insulin 9606 Homo sapiens gi|499141952|pdb|4F4T|C 4F4T_C Chain C, Human Insulin 9606 Homo sapiens gi|499141954|pdb|4F4V|A 4F4V_A Chain A, Human Insulin 9606 Homo sapiens gi|499141956|pdb|4F4V|C 4F4V_C Chain C, Human Insulin 9606 Homo sapiens gi|499141958|pdb|4F51|A 4F51_A Chain A, Human Insulin 9606 Homo sapiens gi|499141960|pdb|4F51|C 4F51_C Chain C, Human Insulin 9606 Homo sapiens gi|507043035|pdb|4F8F|A 4F8F_A Chain A, Human Insulin 9606 Homo sapiens gi|507043037|pdb|4F8F|C 4F8F_C Chain C, Human Insulin 9606 Homo sapiens gi|512125452|pdb|4FG3|A 4FG3_A Chain A, Crystal Structure Analysis of the Human Insulin 9606 Homo sapiens gi|512125454|pdb|4FG3|C 4FG3_C Chain C, Crystal Structure Analysis of the Human Insulin 9606 Homo sapiens gi|512125488|pdb|4GBC|A 4GBC_A Chain A, Crystal structure of aspart insulin at pH 6.5 9606 Homo sapiens gi|512125490|pdb|4GBC|C 4GBC_C Chain C, Crystal structure of aspart insulin at pH 6.5 9606 Homo sapiens gi|512125494|pdb|4GBI|A 4GBI_A Chain A, Crystal structure of aspart insulin at pH 6.5 9606 Homo sapiens gi|512125496|pdb|4GBI|C 4GBI_C Chain C, Crystal structure of aspart insulin at pH 6.5 9606 Homo sapiens gi|512125498|pdb|4GBK|A 4GBK_A Chain A, Crystal structure of aspart insulin at pH 8.5 9606 Homo sapiens gi|512125500|pdb|4GBK|C 4GBK_C Chain C, Crystal structure of aspart insulin at pH 8.5 9606 Homo sapiens gi|512125502|pdb|4GBL|A 4GBL_A Chain A, Crystal structure of aspart insulin at pH 8.5 9606 Homo sapiens gi|512125504|pdb|4GBL|C 4GBL_C Chain C, Crystal structure of aspart insulin at pH 8.5 9606 Homo sapiens gi|512125506|pdb|4GBN|A 4GBN_A Chain A, Crystal Structure Of Aspart Insulin At Ph 6.5 9606 Homo sapiens gi|512125508|pdb|4GBN|C 4GBN_C Chain C, Crystal Structure Of Aspart Insulin At Ph 6.5 9606 Homo sapiens gi|520728516|pdb|3W7Y|A 3W7Y_A Chain A, 0.92A structure of 2Zn human insulin at 100K 9606 Homo sapiens gi|520728518|pdb|3W7Y|C 3W7Y_C Chain C, 0.92A structure of 2Zn human insulin at 100K 9606 Homo sapiens gi|520728520|pdb|3W7Z|A 3W7Z_A Chain A, 1.15A structure of human 2Zn insulin at 293K 9606 Homo sapiens gi|520728522|pdb|3W7Z|C 3W7Z_C Chain C, 1.15A structure of human 2Zn insulin at 293K 9606 Homo sapiens gi|520728524|pdb|3W80|A 3W80_A Chain A, Crystal structure of dodecamer human insulin with double C-axis length of the hexamer 2 Zn insulin cell 9606 Homo sapiens gi|520728526|pdb|3W80|C 3W80_C Chain C, Crystal structure of dodecamer human insulin with double C-axis length of the hexamer 2 Zn insulin cell 9606 Homo sapiens gi|520728528|pdb|3W80|E 3W80_E Chain E, Crystal structure of dodecamer human insulin with double C-axis length of the hexamer 2 Zn insulin cell 9606 Homo sapiens gi|520728530|pdb|3W80|G 3W80_G Chain G, Crystal structure of dodecamer human insulin with double C-axis length of the hexamer 2 Zn insulin cell 9606 Homo sapiens gi|532138145|pdb|3INS|A 3INS_A Chain A, STRUCTURE OF INSULIN. RESULTS OF JOINT NEUTRON AND X-RAY REFINEMENT 9823 Sus scrofa gi|532138147|pdb|3INS|C 3INS_C Chain C, STRUCTURE OF INSULIN. RESULTS OF JOINT NEUTRON AND X-RAY REFINEMENT 9823 Sus scrofa gi|641389695|pdb|4CXL|A 4CXL_A Chain A, Human Insulin Analogue (d-prob8)-insulin 9606 Homo sapiens gi|641389697|pdb|4CXN|A 4CXN_A Chain A, Crystal Structure Of Human Insulin Analogue (nme-alab8)- Insulin Crystal Form I 9606 Homo sapiens gi|641389699|pdb|4CY7|A 4CY7_A Chain A, Crystal Structure Of Human Insulin Analogue (nme-alab8)- Insulin Crystal Form Ii 9606 Homo sapiens gi|641389700|pdb|4CY7|C 4CY7_C Chain C, Crystal Structure Of Human Insulin Analogue (nme-alab8)- Insulin Crystal Form Ii 9606 Homo sapiens gi|651207477|pdb|2MPG|A 2MPG_A Chain A, Solution structure of the [AibB8,LysB28,ProB29]-insulin analogue 9606 Homo sapiens gi|673541188|pdb|2MLI|A 2MLI_A Chain A, NMR structure of B25-(alpha, beta)-dehydro-phenylalanine insulin 9606 Homo sapiens gi|675082456|pdb|4NIB|A 4NIB_A Chain A, Crystal Structure Of Human Insulin Mutant B20 D-ala, B23 D-ala 9606 Homo sapiens gi|675082468|pdb|4OGA|A 4OGA_A Chain A, Insulin in complex with Site 1 of the human insulin receptor 9606 Homo sapiens gi|697351594|pdb|4UNE|A 4UNE_A Chain A, Human insulin B26Phe mutant crystal structure gi|697351596|pdb|4UNE|C 4UNE_C Chain C, Human insulin B26Phe mutant crystal structure gi|697351598|pdb|4UNG|A 4UNG_A Chain A, Human Insulin B26asn Mutant Crystal Structure 9606 Homo sapiens gi|697351600|pdb|4UNG|C 4UNG_C Chain C, Human Insulin B26asn Mutant Crystal Structure 9606 Homo sapiens gi|697351602|pdb|4UNH|A 4UNH_A Chain A, Human Insulin B26gly Mutant Crystal Structure 9606 Homo sapiens gi|699027573|pdb|4P65|A 4P65_A Chain A, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027575|pdb|4P65|C 4P65_C Chain C, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027577|pdb|4P65|E 4P65_E Chain E, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027579|pdb|4P65|G 4P65_G Chain G, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027581|pdb|4P65|I 4P65_I Chain I, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|699027583|pdb|4P65|K 4P65_K Chain K, Crystal Structure Of An Cyclohexylalanine Substituted Insulin Analog. 9606 Homo sapiens gi|731187695|pdb|2MVC|A 2MVC_A Chain A, Solution structure of human insulin at pH 1.9 gi|731187697|pdb|2MVD|A 2MVD_A Chain A, Solution structure of [GlnB22]-insulin mutant at pH 1.9 gi|749197381|pdb|4RXW|A 4RXW_A Chain A, Crystal Structure Of The Cobalt Human Insulin Derivative 9606 Homo sapiens gi|749197383|pdb|4RXW|C 4RXW_C Chain C, Crystal Structure Of The Cobalt Human Insulin Derivative 9606 Homo sapiens gi|756143076|pdb|4XC4|A 4XC4_A Chain A, Insulin co-crystallizes in the presence of it beta-cell chaperone sulfatide 9606 Homo sapiens gi|756143078|pdb|4XC4|C 4XC4_C Chain C, Insulin co-crystallizes in the presence of it beta-cell chaperone sulfatide 9606 Homo sapiens gi|922665160|pdb|5CNY|A 5CNY_A Chain A, Crystal Structure Of Human Zinc Insulin At Ph 5.5 9606 Homo sapiens gi|922665162|pdb|5CNY|C 5CNY_C Chain C, Crystal Structure Of Human Zinc Insulin At Ph 5.5 9606 Homo sapiens gi|922665164|pdb|5CO2|A 5CO2_A Chain A, Crystalization Of Human Zinc Insulin At Ph 5.5 9606 Homo sapiens gi|922665166|pdb|5CO2|C 5CO2_C Chain C, Crystalization Of Human Zinc Insulin At Ph 5.5 9606 Homo sapiens gi|922665168|pdb|5CO6|A 5CO6_A Chain A, Crystal Structure Of Human Zinc Insulin At Ph 6.5 9606 Homo sapiens gi|922665170|pdb|5CO6|C 5CO6_C Chain C, Crystal Structure Of Human Zinc Insulin At Ph 6.5 9606 Homo sapiens gi|922665172|pdb|5CO9|A 5CO9_A Chain A, Crystal Structure Of Human Zinc Insulin At Ph 6.5 9606 Homo sapiens gi|922665174|pdb|5CO9|C 5CO9_C Chain C, Crystal Structure Of Human Zinc Insulin At Ph 6.5 9606 Homo sapiens gi|973744255|pdb|5D52|A 5D52_A Chain A, In Meso In Situ Serial X-ray Crystallography Structure Of Insulin At Room Temperature 9823 Sus scrofa gi|973744257|pdb|5D53|A 5D53_A Chain A, In Meso In Situ Serial X-ray Crystallography Structure Of Insulin At 100 K 9823 Sus scrofa gi|973744259|pdb|5D54|A 5D54_A Chain A, In Meso X-ray Crystallography Structure Of Insulin At 100 K 9823 Sus scrofa gi|973744279|pdb|5D5E|A 5D5E_A Chain A, In Meso In Situ Serial X-ray Crystallography Structure Of Insulin By Sulfur-sad At 100 K 9823 Sus scrofa gi|973744416|pdb|5EN9|A 5EN9_A Chain A, High Resolution X-ray Crystal Structure Of Isotope-labeled Ester- Insulin 9606 Homo sapiens gi|973744418|pdb|5ENA|A 5ENA_A Chain A, Xray Crystal Structure Of Isotope-labeled Human Insulin 9606 Homo sapiens gi|985483653|pdb|2N2V|A 2N2V_A Chain A, Solution structure of [B26-B29 triazole cross-linked]-insulin analogue at pH 1.9 gi|985483655|pdb|2N2W|A 2N2W_A Chain A, Solution structure of [B26-B29 triazole cross-linked]-insulin analogue at pH 8.0 gi|985483657|pdb|2N2X|A 2N2X_A Chain A, Solution structure of [GlyB24,B27-B29 triazole cross-linked]-insulin analogue at pH 1.9 gi|985483911|pdb|5BOQ|A 5BOQ_A Chain A, Human Insulin With Intra-chain Chemical Crosslink Between Modified B24 And B29 9606 Homo sapiens gi|985483913|pdb|5BOQ|C 5BOQ_C Chain C, Human Insulin With Intra-chain Chemical Crosslink Between Modified B24 And B29 9606 Homo sapiens gi|985483915|pdb|5BOQ|E 5BOQ_E Chain E, Human Insulin With Intra-chain Chemical Crosslink Between Modified B24 And B29 9606 Homo sapiens gi|985483917|pdb|5BOQ|G 5BOQ_G Chain G, Human Insulin With Intra-chain Chemical Crosslink Between Modified B24 And B29 9606 Homo sapiens gi|985483919|pdb|5BPO|A 5BPO_A Chain A, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B29 9606 Homo sapiens gi|985483921|pdb|5BPO|C 5BPO_C Chain C, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B29 9606 Homo sapiens gi|985483923|pdb|5BQQ|A 5BQQ_A Chain A, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483925|pdb|5BQQ|C 5BQQ_C Chain C, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483927|pdb|5BQQ|E 5BQQ_E Chain E, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483929|pdb|5BQQ|G 5BQQ_G Chain G, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483931|pdb|5BQQ|I 5BQQ_I Chain I, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|985483933|pdb|5BQQ|K 5BQQ_K Chain K, Human Insulin With Intra-chain Chemical Crosslink Between Modified B27 And B30 9606 Homo sapiens gi|1004171560|pdb|5BTS|A 5BTS_A Chain A, Structural And Biophysical Characterization Of A Covalent Insulin Dimer Formed During Storage Of Neutral Formulation Of Human Insulin 9606 Homo sapiens gi|1036305197|pdb|5FB6|A 5FB6_A Chain A, Room-temperature Macromolecular Crystallography Using A Micro- Patterned Silicon Chip With Minimal Background Scattering 9823 Sus scrofa gi|1049306339|pdb|5LIS|A 5LIS_A Chain A, Insulin Solved By Native Sad From A Dataset Collected In One Second 9823 Sus scrofa gi|1080154851|pdb|5E7W|A 5E7W_A Chain A, X-ray Structure of Human Recombinant 2Zn insulin at 0.92 Angstrom 9606 Homo sapiens gi|1080154853|pdb|5E7W|C 5E7W_C Chain C, X-ray Structure of Human Recombinant 2Zn insulin at 0.92 Angstrom 9606 Homo sapiens gi|1103700630|pdb|5EMS|A 5EMS_A Chain A, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700632|pdb|5EMS|C 5EMS_C Chain C, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700634|pdb|5EMS|E 5EMS_E Chain E, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700636|pdb|5EMS|G 5EMS_G Chain G, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700638|pdb|5EMS|I 5EMS_I Chain I, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1103700640|pdb|5EMS|K 5EMS_K Chain K, Crystal Structure Of An Iodinated Insulin Analog 9606 Homo sapiens gi|1130619681|pdb|5UDP|A 5UDP_A Chain A, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619683|pdb|5UDP|C 5UDP_C Chain C, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619685|pdb|5UDP|E 5UDP_E Chain E, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619687|pdb|5UDP|G 5UDP_G Chain G, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619689|pdb|5UDP|I 5UDP_I Chain I, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1130619691|pdb|5UDP|K 5UDP_K Chain K, High Resolution X-ray Crystal Structure Of Synthetic Insulin Lispro 9606 Homo sapiens gi|1134776108|pdb|5HPR|A 5HPR_A Chain A, Insulin With Proline Analog Hyp At Position B28 In The T2 State 9606 Homo sapiens gi|1134776110|pdb|5HPU|A 5HPU_A Chain A, Insulin with proline analog HyP at position B28 in the R6 state 9606 Homo sapiens gi|1134776112|pdb|5HPU|C 5HPU_C Chain C, Insulin with proline analog HyP at position B28 in the R6 state 9606 Homo sapiens gi|1134776117|pdb|5HQI|A 5HQI_A Chain A, Insulin With Proline Analog Hzp At Position B28 In The T2 State 9606 Homo sapiens gi|1134776131|pdb|5HRQ|A 5HRQ_A Chain A, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776133|pdb|5HRQ|C 5HRQ_C Chain C, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776135|pdb|5HRQ|E 5HRQ_E Chain E, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776137|pdb|5HRQ|G 5HRQ_G Chain G, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776139|pdb|5HRQ|I 5HRQ_I Chain I, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1134776141|pdb|5HRQ|K 5HRQ_K Chain K, Insulin With Proline Analog Hzp At Position B28 In The R6 State 9606 Homo sapiens gi|1175128706|pdb|5MAM|A 5MAM_A Chain A, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128708|pdb|5MAM|C 5MAM_C Chain C, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128710|pdb|5MAM|E 5MAM_E Chain E, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128712|pdb|5MAM|G 5MAM_G Chain G, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128714|pdb|5MAM|I 5MAM_I Chain I, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128716|pdb|5MAM|K 5MAM_K Chain K, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128718|pdb|5MAM|M 5MAM_M Chain M, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128720|pdb|5MAM|O 5MAM_O Chain O, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128722|pdb|5MAM|Q 5MAM_Q Chain Q, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128724|pdb|5MAM|S 5MAM_S Chain S, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128726|pdb|5MAM|U 5MAM_U Chain U, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128728|pdb|5MAM|W 5MAM_W Chain W, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128730|pdb|5MAM|Y 5MAM_Y Chain Y, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128732|pdb|5MAM|0 5MAM_0 Chain 0, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128734|pdb|5MAM|2 5MAM_2 Chain 2, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128736|pdb|5MAM|4 5MAM_4 Chain 4, Human Insulin In Complex With Serotonin 9606 Homo sapiens gi|1175128772|pdb|5MT3|A 5MT3_A Chain A, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128774|pdb|5MT3|C 5MT3_C Chain C, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128776|pdb|5MT3|E 5MT3_E Chain E, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128778|pdb|5MT3|G 5MT3_G Chain G, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128780|pdb|5MT3|I 5MT3_I Chain I, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128782|pdb|5MT3|K 5MT3_K Chain K, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128784|pdb|5MT3|M 5MT3_M Chain M, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128786|pdb|5MT3|O 5MT3_O Chain O, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128788|pdb|5MT3|Q 5MT3_Q Chain Q, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128790|pdb|5MT3|S 5MT3_S Chain S, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128792|pdb|5MT3|U 5MT3_U Chain U, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128794|pdb|5MT3|W 5MT3_W Chain W, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128796|pdb|5MT3|Y 5MT3_Y Chain Y, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128798|pdb|5MT3|AA 5MT3_AA Chain a, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128800|pdb|5MT3|CC 5MT3_CC Chain c, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128802|pdb|5MT3|EE 5MT3_EE Chain e, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128804|pdb|5MT9|A 5MT9_A Chain A, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128806|pdb|5MT9|C 5MT9_C Chain C, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128808|pdb|5MT9|E 5MT9_E Chain E, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128810|pdb|5MT9|G 5MT9_G Chain G, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128812|pdb|5MT9|I 5MT9_I Chain I, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128814|pdb|5MT9|K 5MT9_K Chain K, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128816|pdb|5MT9|M 5MT9_M Chain M, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128818|pdb|5MT9|O 5MT9_O Chain O, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128820|pdb|5MT9|Q 5MT9_Q Chain Q, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128822|pdb|5MT9|S 5MT9_S Chain S, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128824|pdb|5MT9|U 5MT9_U Chain U, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128826|pdb|5MT9|W 5MT9_W Chain W, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128828|pdb|5MT9|Y 5MT9_Y Chain Y, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128830|pdb|5MT9|AA 5MT9_AA Chain a, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128832|pdb|5MT9|CC 5MT9_CC Chain c, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1175128834|pdb|5MT9|EE 5MT9_EE Chain e, Human Insulin In Complex With Serotonin And Arginine 9606 Homo sapiens gi|1189432039|pdb|2MPI|A 2MPI_A Chain A, Solution structure of B24G insulin 9606 Homo sapiens gi|1345621794|pdb|5UOZ|A 5UOZ_A Chain A, Insulin with proline analog FyP at position B28 in the T2 state 9606 Homo sapiens gi|1345622633|pdb|5URT|A 5URT_A Chain A, Insulin with proline analog DhP at position B28 in the T2 state 9606 Homo sapiens gi|1347869623|pdb|5UQA|A 5UQA_A Chain A, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869625|pdb|5UQA|C 5UQA_C Chain C, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869627|pdb|5UQA|E 5UQA_E Chain E, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869629|pdb|5UQA|G 5UQA_G Chain G, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869631|pdb|5UQA|I 5UQA_I Chain I, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869633|pdb|5UQA|K 5UQA_K Chain K, Insulin with proline analog FzP at position B28 in the R6 state 9606 Homo sapiens gi|1347869636|pdb|5URU|A 5URU_A Chain A, Insulin with proline analog DhP at position B28 in the R6 state 9606 Homo sapiens gi|1347869638|pdb|5URU|C 5URU_C Chain C, Insulin with proline analog DhP at position B28 in the R6 state 9606 Homo sapiens gi|1347869640|pdb|5URU|E 5URU_E Chain E, Insulin with proline analog DhP at position B28 in the R6 state 9606 Homo sapiens gi|1347869642|pdb|5URU|G 5URU_G Chain G, Insulin with proline analog DhP at position B28 in the R6 state 9606 Homo sapiens gi|1347869656|pdb|5USP|A 5USP_A Chain A, Insulin with proline analog Pip at position B28 in the T2 state 9606 Homo sapiens gi|1347869658|pdb|5USS|A 5USS_A Chain A, Insulin with proline analog PiP at position B28 in the R6 state 9606 Homo sapiens gi|1347869660|pdb|5USS|C 5USS_C Chain C, Insulin with proline analog PiP at position B28 in the R6 state 9606 Homo sapiens gi|1347869662|pdb|5USV|A 5USV_A Chain A, Insulin with proline analog AzeP at position B28 in the T2 state 9606 Homo sapiens gi|1347869674|pdb|5UU2|A 5UU2_A Chain A, Insulin with proline analog ThioP at position B28 in the T2 state 9606 Homo sapiens gi|1347869676|pdb|5UU3|A 5UU3_A Chain A, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869678|pdb|5UU3|C 5UU3_C Chain C, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869680|pdb|5UU3|E 5UU3_E Chain E, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869682|pdb|5UU3|G 5UU3_G Chain G, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869684|pdb|5UU3|I 5UU3_I Chain I, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869686|pdb|5UU3|K 5UU3_K Chain K, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869688|pdb|5UU3|M 5UU3_M Chain M, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869690|pdb|5UU3|O 5UU3_O Chain O, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869692|pdb|5UU3|Q 5UU3_Q Chain Q, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869694|pdb|5UU3|S 5UU3_S Chain S, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869696|pdb|5UU3|U 5UU3_U Chain U, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869698|pdb|5UU3|W 5UU3_W Chain W, Insulin with proline analog DfP at position B28 in the R6 state 9606 Homo sapiens gi|1347869700|pdb|5UU4|A 5UU4_A Chain A, Insulin with proline analog ThioP at position B28 in the R6 state 9606 Homo sapiens gi|1347869702|pdb|5UU4|C 5UU4_C Chain C, Insulin with proline analog ThioP at position B28 in the R6 state 9606 Homo sapiens gi|1364950891|pdb|6CE7|N 6CE7_N Chain N, Insulin Receptor ectodomain in complex with one insulin molecule gi|1364950899|pdb|6CE9|K 6CE9_K Chain K, Insulin Receptor ectodomain in complex with two insulin molecules gi|1364950901|pdb|6CE9|N 6CE9_N Chain N, Insulin Receptor ectodomain in complex with two insulin molecules gi|1364950909|pdb|6CEB|K 6CEB_K Chain K, Insulin Receptor ectodomain in complex with two insulin molecules - C1 symmetry gi|1364950911|pdb|6CEB|N 6CEB_N Chain N, Insulin Receptor ectodomain in complex with two insulin molecules - C1 symmetry gi|208659|gb|AAA72916.1| AAA72916 insulin alpha chain, partial [synthetic construct] 32630 synthetic construct gi|229104|prf||560164B 560164B insulin 9721 Cetacea 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 653 gnl|mdb|bmrb6205:1 bmrb6205:1 AbaB12-DKP-insulin, chain A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 654 gnl|mdb|bmrb16343:1 bmrb16343:1 INSULIN_A_CHAIN 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 655 gnl|mdb|bmrb19822:1 bmrb19822:1 entity_1 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 656 gnl|mdb|bmrb17107:1 bmrb17107:1 entity_1 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 657 gnl|mdb|bmrb1012:1 bmrb1012:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 658 gnl|mdb|bmrb16663:1 bmrb16663:1 entity, chain 1 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 659 gnl|mdb|bmrb25261:1 bmrb25261:1 entity_1 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 660 gnl|mdb|bmrb1000:1 bmrb1000:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 661 gnl|mdb|bmrb936:1 bmrb936:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 662 gnl|mdb|bmrb1022:1 bmrb1022:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 663 gnl|mdb|bmrb18859:1 bmrb18859:1 entity_1 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 664 gnl|mdb|bmrb6204:1 bmrb6204:1 AlaB12-DKP-insulin, chain A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 665 gnl|mdb|bmrb1016:1 bmrb1016:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 666 gnl|mdb|bmrb18921:1 bmrb18921:1 chain_A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 667 gnl|mdb|bmrb1018:1 bmrb1018:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 668 gnl|mdb|bmrb1006:1 bmrb1006:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 669 gnl|mdb|bmrb1020:1 bmrb1020:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 670 gnl|mdb|bmrb18923:1 bmrb18923:1 chain_A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 671 gnl|mdb|bmrb16026:1 bmrb16026:1 INSULIN_A_CHAIN 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 672 gnl|mdb|bmrb556:1 bmrb556:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 673 gnl|mdb|bmrb15464:1 bmrb15464:1 chain A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 674 gnl|mdb|bmrb1002:1 bmrb1002:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 675 gnl|mdb|bmrb996:1 bmrb996:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 676 gnl|mdb|bmrb1344:1 bmrb1344:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 677 gnl|mdb|bmrb1010:1 bmrb1010:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 678 gnl|mdb|bmrb4997:1 bmrb4997:1 Insulin 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 679 gnl|mdb|bmrb11016:1 bmrb11016:1 Chain A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 680 gnl|mdb|bmrb25614:1 bmrb25614:1 chain_A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 681 gnl|mdb|bmrb25260:1 bmrb25260:1 entity_1 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 682 gnl|mdb|bmrb18924:1 bmrb18924:1 chain_A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 683 gnl|mdb|bmrb554:1 bmrb554:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 684 gnl|mdb|bmrb1632:1 bmrb1632:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 685 gnl|mdb|bmrb998:1 bmrb998:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 686 gnl|mdb|bmrb1761:1 bmrb1761:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 687 gnl|mdb|bmrb25613:1 bmrb25613:1 chain_A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 688 gnl|mdb|bmrb1014:1 bmrb1014:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 689 gnl|mdb|bmrb6203:1 bmrb6203:1 ThrB12-DKP-insulin, chain A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 690 gnl|mdb|bmrb25615:1 bmrb25615:1 chain_A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 691 gnl|mdb|bmrb18925:1 bmrb18925:1 chain_A 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 692 gnl|mdb|bmrb1004:1 bmrb1004:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 693 gnl|mdb|bmrb18858:1 bmrb18858:1 entity_1 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 694 gnl|mdb|bmrb19978:1 bmrb19978:1 entity_1 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 695 gnl|mdb|bmrb994:1 bmrb994:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 696 gnl|mdb|bmrb16027:1 bmrb16027:1 INSULIN_A_CHAIN 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 697 gnl|mdb|bmrb1008:1 bmrb1008:1 insulin A chain 21 1 45.0542 105 0.000208238 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 698 gi|334359036|pdb|2KXK|A 2KXK_A Chain A, Human Insulin Mutant A22Gly-B31Lys-B32Arg 9606 Homo sapiens gi|383875272|pdb|2LGB|A 2LGB_A Chain A, Modified A22Gly-B31Arg Human Insulin 9606 Homo sapiens 22 1 45.0542 105 0.000215944 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 699 gnl|mdb|bmrb16915:1 bmrb16915:1 entity, chain 1 22 1 45.0542 105 0.000215944 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 700 gnl|mdb|bmrb17803:1 bmrb17803:1 InsulinGR 1 22 1 45.0542 105 0.000215944 21 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN 701 gi|928062454|ref|XP_013880765.1| XP_013880765 PREDICTED: insulin-like [Austrofundulus limnaeus] 52670 Austrofundulus limnaeus 111 1 45.4394 106 0.000237255 19 21 25 46 27 48 22 0 QHLCGSHLVEALYLVCGERGFF RHLCGSHLVDALYFVCGERGFF +HLCGSHLV+ALY VCGERGFF 702 gi|831274570|ref|XP_012685986.1| XP_012685986 PREDICTED: uncharacterized protein LOC105902849 [Clupea harengus] 7950 Clupea harengus 251 1 47.3654 111 0.000248997 20 23 25 49 169 193 25 0 QHLCGSHLVEALYLVCGERGFFXTP QYLCGSHLVEALYLVCGDNGFFYSP Q+LCGSHLVEALYLVCG+ GFF +P 703 gi|1020483855|ref|XP_016147491.1| XP_016147491 PREDICTED: insulin-like [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 108 1 45.4394 106 0.000253592 22 27 5 46 6 47 42 0 QCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF QAAAIILLLASLPGSLSTPSQHLCGSNLVDALFLVCGPRGFF Q I L L + +QHLCGS+LV+AL+LVCG RGFF 704 gi|1024983512|ref|XP_016313495.1| XP_016313495 PREDICTED: insulin-like [Sinocyclocheilus anshuiensis] 1608454 Sinocyclocheilus anshuiensis 107 1 45.4394 106 0.000257558 22 27 5 46 6 47 42 0 QCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF QAAVIILLLASLPGSLSTPSQHLCGSNLVDALFLVCGPRGFF Q I L L + +QHLCGS+LV+AL+LVCG RGFF 705 gi|60672450|gb|AAX33331.1| AAX33331 insulin, partial [Microcavia niata] 203484 Microcavia niata 51 1 45.0542 105 0.000258504 19 23 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVNRHLCGSNLVETLYEVCRDKGFFSIP FVN+HLCGS+LVE LY VC ++GFF P 706 gi|32172001|sp|P12704.1|INS_SQUAC P12704 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 7797 Squalus acanthias 54 1 45.0542 105 0.000265008 19 22 24 49 3 28 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SQHLCGSHLVEALYFVCGPKGFYYLP +QHLCGSHLVEALY VCG +GF+ P 707 gi|32172004|sp|P12705.1|INS_TORMA P12705 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 7788 Torpedo marmorata 70 1 45.0542 105 0.000266651 19 22 24 51 3 30 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SQHLCGSHLVEALYFVCGPKGFYYLPKA +QHLCGSHLVEALY VCG +GF+ P 708 gi|1137521934|ref|XP_010887889.2| XP_010887889 PREDICTED: insulin [Esox lucius] 8010 Esox lucius 151 1 45.4394 106 0.000303131 19 21 25 46 69 90 22 0 QHLCGSHLVEALYLVCGERGFF QRLCGSHLVEALFLVCGEKGFF Q LCGSHLVEAL+LVCGE+GFF 709 gi|657530037|ref|XP_008296558.1| XP_008296558 PREDICTED: insulin-like [Stegastes partitus] 144197 Stegastes partitus 112 1 45.4394 106 0.000312922 19 22 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QHLCGAHLVDALYLVCGENGFSYNPGS QHLCG+HLV+ALYLVCGE GF P + 710 gi|78101623|pdb|2BN3|A 2BN3_A Chain A, Insulin Before A High Dose X-Ray Burn 9913 Bos taurus gi|524933733|pdb|4BS3|A 4BS3_A Chain A, Bovin Insulin Structure Determined By In Situ Crystal Analysis And Sulfur-sad Phasing At Room Temperature 9913 Bos taurus 21 1 44.2838 103 0.000322207 20 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSVCSLYQLENYCN GIVEQCCTS+CSLYQLENYCN 711 gi|1168886419|ref|XP_020485413.1| XP_020485413 insulin-like [Labrus bergylta] 56723 Labrus bergylta 102 1 44.669 104 0.000495419 19 21 25 48 20 43 24 0 QHLCGSHLVEALYLVCGERGFFXT QHLCGSRLVDALYFVCGERGFFYS QHLCGS LV+ALY VCGERGFF + 712 gi|1250156307|ref|XP_022618458.1| XP_022618458 insulin-like [Seriola dumerili] 41447 Seriola dumerili gi|109240260|dbj|BAE96119.1| BAE96119 insulin [Seriola dumerili] 41447 Seriola dumerili 115 1 44.669 104 0.000524604 17 24 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT IASQYLCGSHLVDALHLICGDRGFIYMPTS +Q+LCGSHLV+AL+L+CG+RGF P + 713 gi|66360626|pdb|1XW7|A 1XW7_A Chain A, Diabetes-associated Mutations In Human Insulin: Crystal Structure And Photo-cross-linking Studies Of A-chain Variant Insulin Wakayama gi|66360628|pdb|1XW7|C 1XW7_C Chain C, Diabetes-associated Mutations In Human Insulin: Crystal Structure And Photo-cross-linking Studies Of A-chain Variant Insulin Wakayama 21 1 43.5134 101 0.000612975 20 21 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GILEQCCTSICSLYQLENYCN GI+EQCCTSICSLYQLENYCN 714 gi|1207116097|ref|XP_017214511.2| XP_017214511 preproinsulin b isoform X1 [Danio rerio] 7955 Danio rerio 167 1 45.0542 105 0.000648717 20 22 24 48 85 109 25 0 NQHLCGSHLVEALYLVCGERGFFXT SQHLCGSSLVDALYLVCGPRGFFYT +QHLCGS LV+ALYLVCG RGFF T 715 gi|1025148484|ref|XP_016416145.1| XP_016416145 PREDICTED: insulin-like [Sinocyclocheilus rhinocerous] 307959 Sinocyclocheilus rhinocerous 108 1 44.2838 103 0.000679402 19 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QYLCGSHLVDALYLVCGPTGFFYNP Q+LCGSHLV+ALYLVCG GFF P 716 gi|159164730|pdb|2JUM|A 2JUM_A Chain A, ThrA3-DKP-insulin 21 1 43.5134 101 0.000686954 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GITEQCCTSICSLYQLENYCN GI EQCCTSICSLYQLENYCN 717 gnl|mdb|bmrb15450:1 bmrb15450:1 A-chain 21 1 43.5134 101 0.000686954 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GITEQCCTSICSLYQLENYCN GI EQCCTSICSLYQLENYCN 718 gi|1079754243|ref|XP_018546887.1| XP_018546887 PREDICTED: insulin-like [Lates calcarifer] 8187 Lates calcarifer gi|1079754245|ref|XP_018546888.1| XP_018546888 PREDICTED: insulin-like [Lates calcarifer] 8187 Lates calcarifer 115 1 44.2838 103 0.000716261 17 22 23 51 26 54 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT ATHYLCGAHLVDALYFICGERGFFYMPRS +LCG+HLV+ALY +CGERGFF P + 719 gi|1160096936|ref|XP_020376878.1| XP_020376878 insulin [Rhincodon typus] 259920 Rhincodon typus 113 1 44.2838 103 0.000739727 18 22 24 51 27 54 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SQHLCGSQLVDALYFVCGSKGFYYEPKT +QHLCGS LV+ALY VCG +GF+ P T 720 gi|1024975339|ref|XP_016309143.1| XP_016309143 PREDICTED: insulin-like [Sinocyclocheilus anshuiensis] 1608454 Sinocyclocheilus anshuiensis gi|1024975341|ref|XP_016309144.1| XP_016309144 PREDICTED: insulin-like [Sinocyclocheilus anshuiensis] 1608454 Sinocyclocheilus anshuiensis 108 1 44.2838 103 0.000793939 19 21 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP QYLCGSHLVDALYLVCGPTGFFYNP Q+LCGSHLV+ALYLVCG GFF P 721 gi|1007754901|ref|XP_015816886.1| XP_015816886 PREDICTED: insulin-like [Nothobranchius furzeri] 105023 Nothobranchius furzeri 103 1 43.8986 102 0.000842948 18 20 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QKLCGPHLTDALYLVCGERGFLFNPRS Q LCG HL +ALYLVCGERGF P + 722 gi|159162578|pdb|1K3M|A 1K3M_A Chain A, Nmr Structure Of Human Insulin Mutant Ile-A2-Ala, His-B10- Asp, Pro-B28-Lys, Lys-B29-Pro, 15 Structures 32630 synthetic construct 21 1 43.1282 100 0.000871615 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GAVEQCCTSICSLYQLENYCN G VEQCCTSICSLYQLENYCN 723 gi|14719690|pdb|1JCA|A 1JCA_A Chain A, Non-standard Design Of Unstable Insulin Analogues With Enhanced Activity 32630 synthetic construct gi|14719692|pdb|1JCA|C 1JCA_C Chain C, Non-standard Design Of Unstable Insulin Analogues With Enhanced Activity 32630 synthetic construct 21 1 43.1282 100 0.000871615 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCKSICSLYQLENYCN GIVEQCC SICSLYQLENYCN 724 gi|1308584618|ref|XP_023153936.1| XP_023153936 LOW QUALITY PROTEIN: insulin-like [Amphiprion ocellaris] 80972 Amphiprion ocellaris 180 1 44.669 104 0.000876754 18 21 25 48 96 119 24 0 QHLCGSHLVEALYLVCGERGFFXT QHLCGSRLVDALYFVCGERGFYYS QHLCGS LV+ALY VCGERGF+ + 725 gi|1317145254|ref|XP_023285217.1| XP_023285217 insulin-like [Seriola lalandi dorsalis] 1841481 Seriola lalandi dorsalis 115 1 43.8986 102 0.00088722 17 24 22 51 25 54 30 0 FVNQHLCGSHLVEALYLVCGERGFFXTPXT IASQYLCGSHLVDALHLICGDRGFTYMPMS +Q+LCGSHLV+AL+L+CG+RGF P + 726 gi|1345622430|pdb|5MWQ|A 5MWQ_A Chain A, Biosynthetic engineered A21K-B31K-B32R human insulin monomer structure in water/acetonitrile solution 9606 Homo sapiens 21 1 43.1282 100 0.000908441 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCK GIVEQCCTSICSLYQLENYC 727 gi|299299|gb|AAB25816.1| AAB25816 insulin A-chain, partial [Equus przewalskii] 9798 Equus przewalskii 21 1 43.1282 100 0.000908441 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTGICSLYQLENYCN GIVEQCCT ICSLYQLENYCN 728 gnl|mdb|bmrb34087:1 bmrb34087:1 Insulin 21 1 43.1282 100 0.000908441 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCK GIVEQCCTSICSLYQLENYC 729 gi|159164732|pdb|2JUU|A 2JUU_A Chain A, allo-ThrA3 DKP-insulin gi|159164734|pdb|2JUV|A 2JUV_A Chain A, AbaA3-DKP-insulin 21 1 43.1282 100 0.00110567 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIXEQCCTSICSLYQLENYCN GI EQCCTSICSLYQLENYCN 730 gnl|mdb|bmrb15455:1 bmrb15455:1 A_chain 21 1 43.1282 100 0.00110567 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIXEQCCTSICSLYQLENYCN GI EQCCTSICSLYQLENYCN 731 gnl|mdb|bmrb15454:1 bmrb15454:1 allo-Thr_A_chain 21 1 43.1282 100 0.00110567 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIXEQCCTSICSLYQLENYCN GI EQCCTSICSLYQLENYCN 732 gi|229681|pdb|1APH|A 1APH_A Chain A, CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 9913 Bos taurus gi|229722|pdb|1BPH|A 1BPH_A Chain A, CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 9913 Bos taurus gi|229764|pdb|1CPH|A 1CPH_A Chain A, CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 9913 Bos taurus gi|229887|pdb|1DPH|A 1DPH_A Chain A, CONFORMATIONAL CHANGES IN CUBIC INSULIN CRYSTALS IN THE PH RANGE 7-11 9913 Bos taurus gi|230590|pdb|2INS|A 2INS_A Chain A, THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN 9913 Bos taurus gi|230592|pdb|2INS|C 2INS_C Chain C, THE STRUCTURE OF DES-PHE B1 BOVINE INSULIN 9913 Bos taurus gi|1942946|pdb|1PID|A 1PID_A Chain A, Bovine Despentapeptide Insulin 9913 Bos taurus gi|1942948|pdb|1PID|C 1PID_C Chain C, Bovine Despentapeptide Insulin 9913 Bos taurus gi|78101621|pdb|2BN1|A 2BN1_A Chain A, Insulin After A High Dose X-ray Burn 9913 Bos taurus gi|82407658|pdb|2A3G|A 2A3G_A Chain A, The Structure Of T6 Bovine Insulin 9913 Bos taurus gi|82407660|pdb|2A3G|C 2A3G_C Chain C, The Structure Of T6 Bovine Insulin 9913 Bos taurus gi|194368651|pdb|2ZP6|A 2ZP6_A Chain A, Crystal Structure Of Bovine Insulin (Hexameric Form) 9913 Bos taurus gi|194368653|pdb|2ZP6|C 2ZP6_C Chain C, Crystal Structure Of Bovine Insulin (Hexameric Form) 9913 Bos taurus gi|383280399|pdb|4E7T|A 4E7T_A Chain A, The structure of T6 bovine insulin 9913 Bos taurus gi|383280401|pdb|4E7T|C 4E7T_C Chain C, The structure of T6 bovine insulin 9913 Bos taurus gi|383280403|pdb|4E7U|A 4E7U_A Chain A, The structure of T3R3 bovine insulin 9913 Bos taurus gi|383280405|pdb|4E7U|C 4E7U_C Chain C, The structure of T3R3 bovine insulin 9913 Bos taurus gi|383280407|pdb|4E7V|A 4E7V_A Chain A, The structure of R6 bovine insulin 9913 Bos taurus gi|383280409|pdb|4E7V|C 4E7V_C Chain C, The structure of R6 bovine insulin 9913 Bos taurus gi|383280411|pdb|4E7V|E 4E7V_E Chain E, The structure of R6 bovine insulin 9913 Bos taurus gi|383280413|pdb|4E7V|G 4E7V_G Chain G, The structure of R6 bovine insulin 9913 Bos taurus gi|383280415|pdb|4E7V|I 4E7V_I Chain I, The structure of R6 bovine insulin 9913 Bos taurus gi|383280417|pdb|4E7V|K 4E7V_K Chain K, The structure of R6 bovine insulin 9913 Bos taurus gi|383280419|pdb|4E7V|M 4E7V_M Chain M, The structure of R6 bovine insulin 9913 Bos taurus gi|383280421|pdb|4E7V|O 4E7V_O Chain O, The structure of R6 bovine insulin 9913 Bos taurus gi|383280423|pdb|4E7V|Q 4E7V_Q Chain Q, The structure of R6 bovine insulin 9913 Bos taurus gi|383280425|pdb|4E7V|S 4E7V_S Chain S, The structure of R6 bovine insulin 9913 Bos taurus gi|383280427|pdb|4E7V|U 4E7V_U Chain U, The structure of R6 bovine insulin 9913 Bos taurus gi|383280429|pdb|4E7V|W 4E7V_W Chain W, The structure of R6 bovine insulin 9913 Bos taurus gi|383280431|pdb|4E7V|Y 4E7V_Y Chain Y, The structure of R6 bovine insulin 9913 Bos taurus gi|383280433|pdb|4E7V|1 4E7V_1 Chain 1, The structure of R6 bovine insulin 9913 Bos taurus gi|383280435|pdb|4E7V|3 4E7V_3 Chain 3, The structure of R6 bovine insulin 9913 Bos taurus gi|383280437|pdb|4E7V|5 4E7V_5 Chain 5, The structure of R6 bovine insulin 9913 Bos taurus gi|440690602|pdb|3W14|A 3W14_A Chain A, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 9913 Bos taurus gi|440690608|pdb|3W14|I 3W14_I Chain I, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 9913 Bos taurus gi|510102067|pdb|4IDW|A 4IDW_A Chain A, Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution And Novel Structure Refinement Strategy 9913 Bos taurus gi|510102069|pdb|4IDW|C 4IDW_C Chain C, Polycrystalline T6 Bovine Insulin: Anisotropic Lattice Evolution And Novel Structure Refinement Strategy 9913 Bos taurus gi|558704968|pdb|4I5Y|A 4I5Y_A Chain A, Insulin Protein Crystallization Via Langmuir-blodgett 9913 Bos taurus gi|558704970|pdb|4I5Z|A 4I5Z_A Chain A, Insulin Protein Crystallization Via Langmuir-blodgett 9913 Bos taurus gi|568786540|pdb|4IHN|A 4IHN_A Chain A, High Resolution Insulin By Langmuir-blodgett Modified Hanging Drop Vapour Diffusion 9913 Bos taurus gi|574451245|pdb|4M4F|A 4M4F_A Chain A, Radiation damage study of Cu T6-insulin - 0.01 MGy 9913 Bos taurus gi|574451247|pdb|4M4F|C 4M4F_C Chain C, Radiation damage study of Cu T6-insulin - 0.01 MGy 9913 Bos taurus gi|574451249|pdb|4M4H|A 4M4H_A Chain A, Radiation damage study of Cu T6-insulin - 0.06 MGy 9913 Bos taurus gi|574451251|pdb|4M4H|C 4M4H_C Chain C, Radiation damage study of Cu T6-insulin - 0.06 MGy 9913 Bos taurus gi|574451253|pdb|4M4I|A 4M4I_A Chain A, Radiation damage study of Cu T6-insulin - 0.12 MGy 9913 Bos taurus gi|574451255|pdb|4M4I|C 4M4I_C Chain C, Radiation damage study of Cu T6-insulin - 0.12 MGy 9913 Bos taurus gi|574451257|pdb|4M4J|A 4M4J_A Chain A, Radiation damage study of Cu T6-insulin - 0.30 MGy 9913 Bos taurus gi|574451259|pdb|4M4J|C 4M4J_C Chain C, Radiation damage study of Cu T6-insulin - 0.30 MGy 9913 Bos taurus gi|574451261|pdb|4M4L|A 4M4L_A Chain A, The structure of Cu T6 bovine insulin 9913 Bos taurus gi|574451263|pdb|4M4L|C 4M4L_C Chain C, The structure of Cu T6 bovine insulin 9913 Bos taurus gi|574451265|pdb|4M4M|A 4M4M_A Chain A, The structure of Ni T6 bovine insulin 9913 Bos taurus gi|574451267|pdb|4M4M|C 4M4M_C Chain C, The structure of Ni T6 bovine insulin 9913 Bos taurus gi|1134776319|pdb|5MIZ|A 5MIZ_A Chain A, MD ensemble of bovine insulin 9913 Bos taurus gi|1216873254|pdb|5KQV|A 5KQV_A Chain A, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 (revised Structure) 9913 Bos taurus gi|1216873260|pdb|5KQV|I 5KQV_I Chain I, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 (revised Structure) 9913 Bos taurus 21 1 42.743 99 0.0011764 19 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCASVCSLYQLENYCN GIVEQCC S+CSLYQLENYCN 733 gnl|mdb|bmrb1443:1 bmrb1443:1 insulin A chain 21 1 42.743 99 0.0011764 19 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCASVCSLYQLENYCN GIVEQCC S+CSLYQLENYCN 734 gnl|mdb|bmrb1442:1 bmrb1442:1 insulin A chain 21 1 42.743 99 0.0011764 19 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCASVCSLYQLENYCN GIVEQCC S+CSLYQLENYCN 735 gi|14488703|pdb|1J73|A 1J73_A Chain A, Crystal Structure Of An Unstable Insulin Analog With Native Activity. 32630 synthetic construct gi|14488705|pdb|1J73|C 1J73_C Chain C, Crystal Structure Of An Unstable Insulin Analog With Native Activity. 32630 synthetic construct 21 1 42.743 99 0.00122604 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCXSICSLYQLENYCN GIVEQCC SICSLYQLENYCN 736 gi|34810570|pdb|1Q4V|A 1Q4V_A Chain A, Crystal Structure Of Allo-Ilea2-Insulin, An Inactive Chiral Analogue: Implications For The Mechanism Of Receptor 32630 synthetic construct gi|34810572|pdb|1Q4V|C 1Q4V_C Chain C, Crystal Structure Of Allo-Ilea2-Insulin, An Inactive Chiral Analogue: Implications For The Mechanism Of Receptor 32630 synthetic construct gi|159162610|pdb|1KMF|A 1KMF_A Chain A, NMR STRUCTURE OF HUMAN INSULIN MUTANT ILE-A2-ALLO-ILE, HIS-B10-ASP, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES 21 1 42.743 99 0.00123878 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GXVEQCCTSICSLYQLENYCN G VEQCCTSICSLYQLENYCN 737 gnl|mdb|bmrb5246:1 bmrb5246:1 human insulin 21 1 42.743 99 0.00123878 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GXVEQCCTSICSLYQLENYCN G VEQCCTSICSLYQLENYCN 738 gi|584579720|pdb|4IYD|A 4IYD_A Chain A, Insulin Glargine Crystal Structure 1 9606 Homo sapiens gi|584579722|pdb|4IYF|A 4IYF_A Chain A, Insulin Glargine Crystal Structure 2 9606 Homo sapiens gi|1270516718|pdb|5VIZ|A 5VIZ_A Chain A, X-ray Structure Of Insulin Glargine 9606 Homo sapiens 21 1 42.743 99 0.00131799 20 20 1 20 1 20 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCTSICSLYQLENYC GIVEQCCTSICSLYQLENYC 739 gi|225733945|pdb|2WBY|C 2WBY_C Chain C, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Insulin 32630 synthetic construct gi|225733947|pdb|2WBY|E 2WBY_E Chain E, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Insulin 32630 synthetic construct gi|817598834|pdb|4Q5Z|AA 4Q5Z_AA Chain a, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens gi|817598835|pdb|4Q5Z|BB 4Q5Z_BB Chain b, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens gi|817598836|pdb|4Q5Z|CC 4Q5Z_CC Chain c, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens gi|817598837|pdb|4Q5Z|DD 4Q5Z_DD Chain d, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens gi|817598838|pdb|4Q5Z|EE 4Q5Z_EE Chain e, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens gi|817598839|pdb|4Q5Z|FF 4Q5Z_FF Chain f, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens gi|817598840|pdb|4Q5Z|GG 4Q5Z_GG Chain g, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens gi|817598841|pdb|4Q5Z|HH 4Q5Z_HH Chain h, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens gi|1047462994|pdb|5CJO|AA 5CJO_AA Chain a, Crystal Structure Analysis of Elbow-Engineered-Fab-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin gi|1379069551|pdb|5WOB|AA 5WOB_AA Chain a, Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin 9606 Homo sapiens gi|1379069552|pdb|5WOB|BB 5WOB_BB Chain b, Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin 9606 Homo sapiens gi|1379069553|pdb|5WOB|CC 5WOB_CC Chain c, Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin 9606 Homo sapiens gi|1379069554|pdb|5WOB|DD 5WOB_DD Chain d, Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin 9606 Homo sapiens gi|1379069555|pdb|5WOB|EE 5WOB_EE Chain e, Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin 9606 Homo sapiens gi|1379069556|pdb|5WOB|FF 5WOB_FF Chain f, Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin 9606 Homo sapiens gi|1379069557|pdb|5WOB|GG 5WOB_GG Chain g, Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin 9606 Homo sapiens gi|1379069558|pdb|5WOB|HH 5WOB_HH Chain h, Crystal Structure Analysis of Fab1-Bound Human Insulin Degrading Enzyme (IDE) in Complex with Insulin 9606 Homo sapiens 20 1 42.743 99 0.00134186 20 20 1 20 1 20 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCTSICSLYQLENYC GIVEQCCTSICSLYQLENYC 740 gi|927028740|dbj|BAS32707.1| BAS32707 insulin, partial [Homopholis fasciata] 401537 Homopholis fasciata 91 1 43.5134 101 0.00135634 18 22 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQHLCGHQLVEALIMVCGDRGFYYGP F +QHLCG LVEAL +VCG+RGF+ P 741 gi|927028736|dbj|BAS32705.1| BAS32705 insulin, partial [Phelsuma laticauda] 143529 Phelsuma laticauda 91 1 43.1282 100 0.00143859 18 22 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQHLCGHQLVEALLMVCGDRGFYYGP F +QHLCG LVEAL +VCG+RGF+ P 742 gi|60672476|gb|AAX33344.1| AAX33344 insulin, partial [Ctenomys robore] 316387 Ctenomys robore 52 1 42.743 99 0.00148431 17 21 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YASQHLCGSHLVEALYMTCGHNGFY + +QHLCGSHLVEALY+ CG GF+ 743 gi|157838277|pdb|1BEN|A 1BEN_A Chain A, Insulin Complexed With 4-Hydroxybenzamide 32630 synthetic construct gi|157838279|pdb|1BEN|C 1BEN_C Chain C, Insulin Complexed With 4-Hydroxybenzamide 32630 synthetic construct gi|159162692|pdb|1MHI|A 1MHI_A Chain A, THREE-DIMENSIONAL SOLUTION STRUCTURE OF AN INSULIN DIMER. A STUDY OF THE B9(ASP) MUTANT OF HUMAN INSULIN USING NUCLEAR MAGNETIC RESONANCE DISTANCE GEOMETRY AND RESTRAINED MOLECULAR DYNAMICS 9606 Homo sapiens 21 1 42.743 99 0.00149187 20 20 2 21 2 21 20 0 IVEQCCTSICSLYQLENYCN IVEQCCTSICSLYQLENYCN IVEQCCTSICSLYQLENYCN 744 gnl|mdb|bmrb1587:1 bmrb1587:1 insulin A chain 21 1 42.743 99 0.00149187 20 20 2 21 2 21 20 0 IVEQCCTSICSLYQLENYCN IVEQCCTSICSLYQLENYCN IVEQCCTSICSLYQLENYCN 745 gnl|mdb|bmrb1585:1 bmrb1585:1 insulin A chain 21 1 42.743 99 0.00149187 20 20 2 21 2 21 20 0 IVEQCCTSICSLYQLENYCN IVEQCCTSICSLYQLENYCN IVEQCCTSICSLYQLENYCN 746 gi|60672472|gb|AAX33342.1| AAX33342 insulin, partial [Ctenomys leucodon] 61871 Ctenomys leucodon gi|60672474|gb|AAX33343.1| AAX33343 insulin, partial [Ctenomys rionegrensis] 88126 Ctenomys rionegrensis 52 1 42.743 99 0.00151479 17 21 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YASQHLCGSHLVEALYMTCGHNGFY + +QHLCGSHLVEALY+ CG GF+ 747 gi|927028738|dbj|BAS32706.1| BAS32706 insulin, partial [Lygodactylus kimhowelli] 768702 Lygodactylus kimhowelli 91 1 43.1282 100 0.00152579 18 22 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQHLCGHQLVEALLMVCGDRGFYYGP F +QHLCG LVEAL +VCG+RGF+ P 748 gi|459358632|pdb|4EFX|A 4EFX_A Chain A, Highly Biologically Active Insulin With Additional Disulfide Bond 9606 Homo sapiens gi|459358634|pdb|4EFX|C 4EFX_C Chain C, Highly Biologically Active Insulin With Additional Disulfide Bond 9606 Homo sapiens 21 1 42.3578 98 0.00185286 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSCCSLYQLENYCN GIVEQCCTS CSLYQLENYCN 749 gi|61679821|pdb|1RWE|A 1RWE_A Chain A, Enhancing The Activity Of Insulin At Receptor Edge: Crystal Structure And Photo-Cross-Linking Of A8 Analogues 32630 synthetic construct gi|61679823|pdb|1RWE|C 1RWE_C Chain C, Enhancing The Activity Of Insulin At Receptor Edge: Crystal Structure And Photo-Cross-Linking Of A8 Analogues 32630 synthetic construct gi|159162500|pdb|1IOH|A 1IOH_A Chain A, INSULIN MUTANT A8 HIS,(B1, B10, B16, B27)GLU, DES-B30, NMR, 26 STRUCTURES 9606 Homo sapiens 21 1 42.3578 98 0.00185286 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHSICSLYQLENYCN GIVEQCC SICSLYQLENYCN 750 gi|927028748|dbj|BAS32711.1| BAS32711 insulin, partial [Stenodactylus sthenodactylus] 930226 Stenodactylus sthenodactylus 91 1 42.743 99 0.00202721 17 23 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FLSQYLCGPQLVDALVLVCGDRGFYYNP F++Q+LCG LV+AL LVCG+RGF+ P 751 gi|159162498|pdb|1IOG|A 1IOG_A Chain A, INSULIN MUTANT A3 GLY,(B1, B10, B16, B27)GLU, DES-B30, NMR, 19 STRUCTURES 9606 Homo sapiens 21 1 42.3578 98 0.00205413 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIGEQCCTSICSLYQLENYCN GI EQCCTSICSLYQLENYCN 752 gnl|mdb|bmrb1024:1 bmrb1024:1 insulin A chain 22 1 42.3578 98 0.00206338 20 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLXQLENYCN GIVEQCCTSICSL QLENYCN 753 gi|927028746|dbj|BAS32710.1| BAS32710 insulin, partial [Cyrtodactylus quadrivirgatus] 751993 Cyrtodactylus quadrivirgatus 89 1 42.3578 98 0.00280118 17 22 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQHLCGRQLVEALALICGDQGFYYNP F +QHLCG LVEAL L+CG++GF+ P 754 gi|927028734|dbj|BAS32704.1| BAS32704 insulin, partial [Chondrodactylus turneri] 401559 Chondrodactylus turneri 91 1 42.3578 98 0.0028547 19 26 10 49 5 43 40 1 ICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP IAVLAPIANHA-FPSQHFCGKQLVDALILICGDRGFYFNP I L + N+ F +QH CG LV+AL L+CG+RGF+ P 755 gi|849982693|gb|AKN46136.1| AKN46136 insulin-like protein isoform 1 ILP1 [Desmognathus ocoee] 179530 Desmognathus ocoee 105 1 42.3578 98 0.0033129 17 20 22 45 24 47 24 0 FVNQHLCGSHLVEALYLVCGERGF FSDQHLCGDQLVDALRVVCGERGF F +QHLCG LV+AL +VCGERGF 756 gi|849982723|gb|AKN46137.1| AKN46137 insulin-like protein isoform 2 ILP2 [Desmognathus ocoee] 179530 Desmognathus ocoee 105 1 42.3578 98 0.00347768 17 20 22 45 24 47 24 0 FVNQHLCGSHLVEALYLVCGERGF FSDQHLCGDQLVDALRVVCGERGF F +QHLCG LV+AL +VCGERGF 757 gi|1308385031|ref|XP_023122406.1| XP_023122406 insulin-like [Amphiprion ocellaris] 80972 Amphiprion ocellaris gi|1308385034|ref|XP_023122407.1| XP_023122407 insulin-like [Amphiprion ocellaris] 80972 Amphiprion ocellaris 115 1 42.3578 98 0.00357049 18 20 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGAHLVDALYLVCWENGFTYNP QHLCG+HLV+ALYLVC E GF P 758 gi|1020481553|ref|XP_016146252.1| XP_016146252 PREDICTED: insulin-like [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 108 1 42.3578 98 0.00358171 18 20 25 49 27 51 25 0 QHLCGSHLVEALYLVCGERGFFXTP HYLCGSHLVDALYLVCGPTGFFFNP +LCGSHLV+ALYLVCG GFF P 759 gi|1129939369|ref|XP_019728907.1| XP_019728907 PREDICTED: insulin-like [Hippocampus comes] 109280 Hippocampus comes 116 1 42.3578 98 0.0036922 16 23 22 48 25 51 27 0 FVNQHLCGSHLVEALYLVCGERGFFXT YSSKHLCGPNLVEALSMVCGDRGFFTS + ++HLCG +LVEAL +VCG+RGFF + 760 gi|1229014442|ref|XP_022072627.1| XP_022072627 insulin-like [Acanthochromis polyacanthus] 80966 Acanthochromis polyacanthus 152 1 42.743 99 0.00371857 18 20 25 49 65 89 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGAHLVDALYLVCWENGFSYNP QHLCG+HLV+ALYLVC E GF P 761 gi|1143425084|ref|XP_019966766.1| XP_019966766 PREDICTED: insulin-like [Paralichthys olivaceus] 8255 Paralichthys olivaceus 116 1 41.9726 97 0.00403142 17 20 25 49 30 54 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGAQLVDTLYQVCSEKGFFYTP QHLCG+ LV+ LY VC E+GFF TP 762 gi|225734317|pdb|3GKY|A 3GKY_A Chain A, The Structural Basis of an ER Stress-Associated Bottleneck in a Protein Folding Landscape gi|225734319|pdb|3GKY|C 3GKY_C Chain C, The Structural Basis of an ER Stress-Associated Bottleneck in a Protein Folding Landscape 21 1 41.2022 95 0.00449088 19 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHSICSLYQVENYCN GIVEQCC SICSLYQ+ENYCN 763 gi|927028732|dbj|BAS32703.1| BAS32703 insulin, partial [Paroedura picta] 143630 Paroedura picta 91 1 41.9726 97 0.00469543 17 20 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPEQRLCGRQLVEALVLICGDRGFYYNP F Q LCG LVEAL L+CG+RGF+ P 764 gi|927028724|dbj|BAS32699.1| BAS32699 insulin [Gekko gecko] 36310 Gekko gecko 100 1 41.9726 97 0.00485118 17 22 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQYLCGRQLVDALILVCGDRGFYWGP F +Q+LCG LV+AL LVCG+RGF+ P 765 gi|387059|gb|AAA37041.1| AAA37041 insulin [Cavia porcellus] 10141 Cavia porcellus 110 1 41.9726 97 0.00506894 18 22 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVSRHLCGSNLVETLYSVCQDDGFFYIP FV++HLCGS+LVE LY VC + GFF P 766 gi|60672446|gb|AAX33329.1| AAX33329 insulin, partial [Cavia porcellus] 10141 Cavia porcellus gi|60672448|gb|AAX33330.1| AAX33330 insulin, partial [Cavia aperea] 37548 Cavia aperea 51 1 41.2022 95 0.00526845 18 22 22 49 1 28 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVSRHLCGSNLVETLYSVCQDDGFFYIP FV++HLCGS+LVE LY VC + GFF P 767 gi|225733946|pdb|2WBY|D 2WBY_D Chain D, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Insulin 32630 synthetic construct gi|225733948|pdb|2WBY|F 2WBY_F Chain F, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Insulin 32630 synthetic construct gi|817598842|pdb|4Q5Z|XX 4Q5Z_XX Chain x, Crystal Structure Analysis Of Fab-bound Human Insulin Degrading Enzyme (ide) In Complex With Insulin 9606 Homo sapiens 19 1 41.2022 95 0.00533442 19 19 22 40 1 19 19 0 FVNQHLCGSHLVEALYLVC FVNQHLCGSHLVEALYLVC FVNQHLCGSHLVEALYLVC 768 gi|927028728|dbj|BAS32701.1| BAS32701 insulin, partial [Gekko vittatus] 278186 Gekko vittatus 91 1 41.5874 96 0.00570522 17 22 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQYLCGRQLVDALILVCGDRGFYWGP F +Q+LCG LV+AL LVCG+RGF+ P 769 gi|927028726|dbj|BAS32700.1| BAS32700 insulin [Gekko badenii] 1085617 Gekko badenii 100 1 41.5874 96 0.00577699 17 22 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQYLCGRQLVDALILVCGDRGFYWGP F +Q+LCG LV+AL LVCG+RGF+ P 770 gi|290542351|ref|NP_001166362.1| NP_001166362 insulin precursor [Cavia porcellus] 10141 Cavia porcellus gi|884909243|ref|XP_013006103.1| XP_013006103 insulin isoform X1 [Cavia porcellus] 10141 Cavia porcellus gi|124581|sp|P01329.2|INS_CAVPO P01329 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 10141 Cavia porcellus gi|305337|gb|AAA37042.1| AAA37042 preproinsulin [Cavia porcellus] 10141 Cavia porcellus 110 1 41.5874 96 0.00592273 18 22 22 49 25 52 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FVSRHLCGSNLVETLYSVCQDDGFFYIP FV++HLCGS+LVE LY VC + GFF P 771 gi|226296|prf||1506296A 1506296A insulin A 9317 Macropus giganteus 21 1 40.817 94 0.00630163 19 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCNSICSLYQLETYCN GIVEQCC SICSLYQLE YCN 772 gi|1586109|prf||2203282B 2203282B insulin:SUBUNIT=B chain 71168 Geotria australis 36 1 40.817 94 0.00653542 17 20 24 48 8 32 25 0 NQHLCGSHLVEALYLVCGERGFFXT GNYLCGSYLVDALYLACGPRGFFYT +LCGS+LV+ALYL CG RGFF T 773 gi|1011566505|gb|KYO22155.1| KYO22155 insulin [Alligator mississippiensis] 8496 Alligator mississippiensis 147 1 41.9726 97 0.0067214 18 19 1 21 127 147 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHNTCSLYQLENYCN GIVEQCC + CSLYQLENYCN 774 gi|289526759|pdb|3KQ6|A 3KQ6_A Chain A, Enhancing The Therapeutic Properties Of A Protein By A Desig Binding Site, Structural Principles Of A Novel Long-Acting Analog 9606 Homo sapiens gi|289526761|pdb|3KQ6|C 3KQ6_C Chain C, Enhancing The Therapeutic Properties Of A Protein By A Desig Binding Site, Structural Principles Of A Novel Long-Acting Analog 9606 Homo sapiens 21 1 40.817 94 0.00750151 19 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVHQCCHSICSLYQLENYCN GIV QCC SICSLYQLENYCN 775 gi|1189450106|pdb|5AZZ|A 5AZZ_A Chain A, Crystal Structure Of Seleno-insulin 9913 Bos taurus 22 1 40.817 94 0.0080094 18 19 1 22 1 22 22 0 GIVEQCCTSICSLYQLENYCNF GIVEQCXASVCSLYQLENYCNM GIVEQC S+CSLYQLENYCN 776 gi|255311787|pdb|3FQ9|A 3FQ9_A Chain A, Design Of An Insulin Analog With Enhanced Receptor-Binding Selectivity. Rationale, Structure, And Therapeutic Implications 32630 synthetic construct gi|255311789|pdb|3FQ9|C 3FQ9_C Chain C, Design Of An Insulin Analog With Enhanced Receptor-Binding Selectivity. Rationale, Structure, And Therapeutic Implications 32630 synthetic construct 21 1 40.4318 93 0.00874753 19 19 2 21 2 21 20 0 IVEQCCTSICSLYQLENYCN IVEQCCXSICSLYQLENYCN IVEQCC SICSLYQLENYCN 777 gi|159163243|pdb|1VKT|A 1VKT_A Chain A, Human Insulin Two Disulfide Model, Nmr, 10 Structures 9606 Homo sapiens 21 1 40.4318 93 0.00902042 19 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQSCTSISSLYQLENYCN GIVEQ CTSI SLYQLENYCN 778 gi|1025368521|ref|XP_016397135.1| XP_016397135 PREDICTED: insulin-like [Sinocyclocheilus rhinocerous] 307959 Sinocyclocheilus rhinocerous 114 1 41.2022 95 0.00953599 19 27 9 49 10 50 41 0 SICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP SLCAGSLVTHSGAFGNRRLCGTQLVEALLLVCGDKGLFYQP S+C+ + + F N+ LCG+ LVEAL LVCG++G F P 779 gi|1020506075|ref|XP_016091998.1| XP_016091998 PREDICTED: insulin-like [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 114 1 41.2022 95 0.00972463 19 27 9 49 10 50 41 0 SICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTP SLCAGSLVTHSGAFGNRRLCGTQLVEALLLVCGDKGLFYQP S+C+ + + F N+ LCG+ LVEAL LVCG++G F P 780 gi|1169060432|ref|XP_020443020.1| XP_020443020 insulin-like [Monopterus albus] 43700 Monopterus albus 115 1 41.2022 95 0.0097754 17 19 25 48 29 52 24 0 QHLCGSHLVEALYLVCGERGFFXT HHWCGSHLVEALYRVCGDSGFYNT H CGSHLVEALY VCG+ GF+ T 781 gi|1129981701|ref|XP_019747543.1| XP_019747543 PREDICTED: insulin-like isoform X3 [Hippocampus comes] 109280 Hippocampus comes gi|1129981703|ref|XP_019747545.1| XP_019747545 PREDICTED: insulin-like isoform X3 [Hippocampus comes] 109280 Hippocampus comes 116 1 41.2022 95 0.00992591 17 20 25 49 26 50 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSDLLDALILVCGDRGFIFNP QHLCGS L++AL LVCG+RGF P 782 gi|1129981695|ref|XP_019747540.1| XP_019747540 PREDICTED: insulin-like isoform X1 [Hippocampus comes] 109280 Hippocampus comes gi|1129981697|ref|XP_019747541.1| XP_019747541 PREDICTED: insulin-like isoform X1 [Hippocampus comes] 109280 Hippocampus comes gi|1129981699|ref|XP_019747542.1| XP_019747542 PREDICTED: insulin-like isoform X2 [Hippocampus comes] 109280 Hippocampus comes 143 1 41.2022 95 0.0103334 17 20 25 49 53 77 25 0 QHLCGSHLVEALYLVCGERGFFXTP QHLCGSDLLDALILVCGDRGFIFNP QHLCGS L++AL LVCG+RGF P 783 gi|345110696|pdb|2L1Z|A 2L1Z_A Chain A, NMR Structure of human insulin mutant GLY-B20-D-ALA, GLY-B23-D-ALA PRO-B28-LYS, LYS-B29-PRO, 20 Structures 9606 Homo sapiens gi|429544227|pdb|3V19|A 3V19_A Chain A, Forestalling Insulin Fibrillation By Insertion Of A Chiral Clamp Mechanism-Based Application Of Protein Engineering To Global Health 9606 Homo sapiens gi|429544229|pdb|3V19|C 3V19_C Chain C, Forestalling Insulin Fibrillation By Insertion Of A Chiral Clamp Mechanism-Based Application Of Protein Engineering To Global Health 9606 Homo sapiens 21 1 40.4318 93 0.0105172 18 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GLLEQCCHSICSLYQLENYCN G++EQCC SICSLYQLENYCN 784 gnl|mdb|bmrb17108:1 bmrb17108:1 entity_1 21 1 40.4318 93 0.0105172 18 20 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GLLEQCCHSICSLYQLENYCN G++EQCC SICSLYQLENYCN 785 gi|1334734|emb|CAA23708.1| CAA23708 unnamed protein product, partial [Gallus gallus] 9031 Gallus gallus 45 1 40.4318 93 0.0106453 18 19 1 21 25 45 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHNTCSLYQLENYCN GIVEQCC + CSLYQLENYCN 786 gi|60672466|gb|AAX33339.1| AAX33339 insulin, partial [Spalacopus cyanus] 61880 Spalacopus cyanus 52 1 40.4318 93 0.0128892 16 21 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YSSQHLCGSNLVEALYMTCGRSGFY + +QHLCGS+LVEALY+ CG GF+ 787 gi|47209230|emb|CAF93217.1| CAF93217 unnamed protein product [Tetraodon nigroviridis] 99883 Tetraodon nigroviridis 89 1 40.4318 93 0.0142561 16 19 25 46 23 44 22 0 QHLCGSHLVEALYLVCGERGFF QHLCGSQLVDTLYFICGERGFY QHLCGS LV+ LY +CGERGF+ 788 gi|507628226|ref|XP_004627141.1| XP_004627141 insulin [Octodon degus] 10160 Octodon degus gi|124651|sp|P17715.2|INS_OCTDE P17715 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 10160 Octodon degus gi|202472|gb|AAA40590.1| AAA40590 insulin [Octodon degus] 10160 Octodon degus 109 1 40.4318 93 0.015782 16 21 22 46 25 49 25 0 FVNQHLCGSHLVEALYLVCGERGFF YSSQHLCGSNLVEALYMTCGRSGFY + +QHLCGS+LVEALY+ CG GF+ 789 gi|1137491991|ref|XP_019901337.1| XP_019901337 PREDICTED: uncharacterized protein LOC105007078 [Esox lucius] 8010 Esox lucius 249 1 41.9726 97 0.0169749 19 20 24 49 39 64 26 0 NQHLCGSHLVEALYLVCGERGFFXTP TQLLCGSQLVDALYLVCGENGFFYNP Q LCGS LV+ALYLVCGE GFF P 790 gi|1025092857|ref|XP_016343268.1| XP_016343268 PREDICTED: insulin-like [Sinocyclocheilus anshuiensis] 1608454 Sinocyclocheilus anshuiensis 114 1 40.4318 93 0.017184 17 21 22 49 23 50 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FGNRRLCGTQLVEALLLVCGDKGLFYQP F N+ LCG+ LVEAL LVCG++G F P 791 gi|60672470|gb|AAX33341.1| AAX33341 insulin, partial [Octodontomys gliroides] 170740 Octodontomys gliroides 52 1 40.0466 92 0.017236 16 21 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YSSQHLCGSNLVEALYMTCGHNGFY + +QHLCGS+LVEALY+ CG GF+ 792 gi|60672468|gb|AAX33340.1| AAX33340 insulin, partial [Octodon degus] 10160 Octodon degus 52 1 40.0466 92 0.0174094 16 21 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YSSQHLCGSNLVEALYMTCGRSGFY + +QHLCGS+LVEALY+ CG GF+ 793 gi|1304111279|pdb|5T7R|A 5T7R_A Chain A, A6-A11 trans-dicarba human insulin gi|1304111281|pdb|5T7R|C 5T7R_C Chain C, A6-A11 trans-dicarba human insulin 21 1 39.6614 91 0.0180743 19 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQXCTSIXSLYQLENYCN GIVEQ CTSI SLYQLENYCN 794 gi|208433|gb|AAA72203.1| AAA72203 insulin-like growth factor, partial [synthetic construct] 32630 synthetic construct 70 1 40.0466 92 0.0181665 17 21 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QALCGAELVDALYLVCGDRGFYFNKPT Q LCG+ LV+ALYLVCG+RGF+ T 795 gi|159162650|pdb|1LKQ|A 1LKQ_A Chain A, NMR STRUCTURE OF HUMAN INSULIN MUTANT ILE-A2-GLY, VAL-A3-GLY, HIS-B10-ASP, PRO-B28-LYS, LYS-B29-PRO, 20 STRUCTURES 21 1 39.6614 91 0.018636 19 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GGGEQCCTSICSLYQLENYCN G EQCCTSICSLYQLENYCN 796 gi|60672460|gb|AAX33336.1| AAX33336 insulin, partial [Tympanoctomys barrerae] 61882 Tympanoctomys barrerae 52 1 39.6614 91 0.0188606 16 21 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YSSQHLCGSNLVEALYMTCGHSGFY + +QHLCGS+LVEALY+ CG GF+ 797 gi|60672462|gb|AAX33337.1| AAX33337 insulin, partial [Octomys mimax] 135583 Octomys mimax gi|60672464|gb|AAX33338.1| AAX33338 insulin, partial [Aconaemys fuscus] 183514 Aconaemys fuscus 52 1 39.6614 91 0.0198278 16 21 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YSSQHLCGSNLVEALYMTCGHSGFY + +QHLCGS+LVEALY+ CG GF+ 798 gi|1249032953|ref|XP_007247543.2| XP_007247543 insulin-like [Astyanax mexicanus] 7994 Astyanax mexicanus 108 1 40.0466 92 0.0200515 17 20 24 46 25 47 23 0 NQHLCGSHLVEALYLVCGERGFF SQYLCGSSLVDALYFVCGARGFF +Q+LCGS LV+ALY VCG RGFF 799 gi|1881820|gb|AAB49512.1| AAB49512 insulin A chain [Ornithorhynchus anatinus=platypuses, pancreas, Peptide, 21 aa] 9258 Ornithorhynchus anatinus gi|1589401|prf||2211251A 2211251A insulin:SUBUNIT=A chain 9258 Ornithorhynchus anatinus 21 1 39.2762 90 0.0228507 16 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEECCKGVCSMYQLENYCN GIVE+CC +CS+YQLENYCN 800 gi|927028742|dbj|BAS32708.1| BAS32708 insulin, partial [Hemidactylus platyurus] 498596 Hemidactylus platyurus 90 1 39.6614 91 0.027384 16 20 24 49 18 43 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SQYLCGPQLVEALVFVCGDRGFYQNP +Q+LCG LVEAL VCG+RGF+ P 801 gi|928079158|ref|XP_013889654.1| XP_013889654 PREDICTED: insulin-like [Austrofundulus limnaeus] 52670 Austrofundulus limnaeus 114 1 39.6614 91 0.0278588 19 21 24 49 28 51 26 2 NQHLCGSHLVEALYLVCGERGFFXTP SQHLCGSHLVDALYLVCG--GLFYNP +QHLCGSHLV+ALYLVCG G F P 802 gi|1025241551|ref|XP_016366606.1| XP_016366606 PREDICTED: uncharacterized protein LOC107707184 [Sinocyclocheilus rhinocerous] 307959 Sinocyclocheilus rhinocerous 243 1 41.2022 95 0.0349949 17 23 24 48 25 49 25 0 NQHLCGSHLVEALYLVCGERGFFXT SQHLCGSNLVDALFLVCGPKGFFYS +QHLCGS+LV+AL+LVCG +GFF + 803 gi|124650|sp|P01342.1|INS_MYXGL P01342 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain; Flags: Precursor 7769 Myxine glutinosa gi|64093|emb|CAA23993.1| CAA23993 unnamed protein product [Myxine glutinosa] 7769 Myxine glutinosa 115 1 39.2762 90 0.0370337 16 17 26 49 31 54 24 0 HLCGSHLVEALYLVCGERGFFXTP HLCGKDLVNALYIACGVRGFFYDP HLCG LV ALY+ CG RGFF P 804 gi|927028730|dbj|BAS32702.1| BAS32702 insulin, partial [Gekko monarchus] 655677 Gekko monarchus 91 1 39.2762 90 0.0393036 16 20 24 49 18 43 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SQYLCGRQLVEAFILVCGDRGFYWGP +Q+LCG LVEA LVCG+RGF+ P 805 gi|927028722|dbj|BAS32698.1| BAS32698 insulin, partial [Gekko hokouensis] 146910 Gekko hokouensis 90 1 39.2762 90 0.0399387 15 22 22 49 16 43 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FPSQYLCGRQLVDSLNLICGDRGFYWGP F +Q+LCG LV++L L+CG+RGF+ P 806 gi|927028744|dbj|BAS32709.1| BAS32709 insulin, partial [Hemidactylus frenatus] 47729 Hemidactylus frenatus 90 1 39.2762 90 0.0427367 16 20 22 46 16 40 25 0 FVNQHLCGSHLVEALYLVCGERGFF YPNQYLCGPQLVEALAFVCGDRGFY + NQ+LCG LVEAL VCG+RGF+ 807 gi|1025352986|ref|XP_016395394.1| XP_016395394 PREDICTED: insulin-like [Sinocyclocheilus rhinocerous] 307959 Sinocyclocheilus rhinocerous 183 1 40.4318 93 0.0457844 20 25 9 46 68 105 38 0 SICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF SLCAGSLVTNSGAFGNRRLCGIQLVEALLLVCGEKGLF S+C+ + N F N+ LCG LVEAL LVCGE+G F 808 gi|208429|gb|AAA72201.1| AAA72201 insulin-like growth factor I, partial [synthetic construct] 32630 synthetic construct 70 1 38.5058 88 0.0636271 16 21 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALYLVCGDRGFYFNKPT + LCG+ LV+ALYLVCG+RGF+ T 809 gi|1699409|gb|AAB37516.1| AAB37516 insulin A chain [Cairina moschata] 8855 Cairina moschata 21 1 38.1206 87 0.0705461 17 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEECCENPCSLYQLENYCN GIVE+CC + CSLYQLENYCN 810 gi|1049228971|ref|XP_017552860.1| XP_017552860 PREDICTED: insulin-like [Pygocentrus nattereri] 42514 Pygocentrus nattereri 112 1 38.5058 88 0.0747417 17 19 22 49 23 50 28 0 FVNQHLCGSHLVEALYLVCGERGFFXTP FGNRRLCGIQLVEALLFVCGEKGLFYQP F N+ LCG LVEAL VCGE+G F P 811 gi|831298283|ref|XP_012681001.1| XP_012681001 PREDICTED: insulin-like [Clupea harengus] 7950 Clupea harengus 118 1 38.5058 88 0.078225 16 18 25 49 31 55 25 0 QHLCGSHLVEALYLVCGERGFFXTP RRLCGVHLVDALLFVCGERGLFYQP + LCG HLV+AL VCGERG F P 812 gi|1042310109|ref|XP_017351248.1| XP_017351248 PREDICTED: insulin-like [Ictalurus punctatus] 7998 Ictalurus punctatus 108 1 38.1206 87 0.0985679 18 23 11 46 12 47 36 0 CSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF CSVALLRPGAGFGSRRLCGVQLVEALLLVCGDKGLF CS+ L F ++ LCG LVEAL LVCG++G F 813 gi|281500600|pdb|2W44|A 2W44_A Chain A, Structure DeltaA1-A4 insulin 9606 Homo sapiens gi|281500602|pdb|2W44|C 2W44_C Chain C, Structure DeltaA1-A4 insulin 9606 Homo sapiens gi|281500604|pdb|2W44|E 2W44_E Chain E, Structure DeltaA1-A4 insulin 9606 Homo sapiens 17 1 37.3502 85 0.138689 17 17 5 21 1 17 17 0 QCCTSICSLYQLENYCN QCCTSICSLYQLENYCN QCCTSICSLYQLENYCN 814 gi|1586831|prf||2204398A 2204398A insulin:SUBUNIT=A chain 8456 Typhlonectes natans 21 1 36.965 84 0.191539 16 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEKCCLSTCSLYELESYCN GIVE+CC S CSLY+LE+YCN 815 gi|927028756|dbj|BAS32715.1| BAS32715 insulin, partial [Gonatodes albogularis] 460622 Gonatodes albogularis 91 1 37.3502 85 0.192307 16 18 24 46 18 40 23 0 NQHLCGSHLVEALYLVCGERGFF SQHLCGPALVEAIEFVCGERGVF +QHLCG LVEA+ VCGERG F 816 gi|1246089|gb|AAB35905.1| AAB35905 insulin A-chian [Amphiuma tridactylum=three-toed amphiuma, pancreatic extract, Peptide, 23 aa] 8313 Amphiuma tridactylum 23 1 36.965 84 0.192876 17 18 1 21 3 23 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHNTCSLNQLENYCN GIVEQCC + CSL QLENYCN 817 gi|556961330|ref|XP_005991005.1| XP_005991005 PREDICTED: insulin-like growth factor III [Latimeria chalumnae] 7897 Latimeria chalumnae 130 1 37.7354 86 0.201999 15 18 23 46 54 77 24 0 VNQHLCGSHLVEALYLVCGERGFF ANEMLCGSELVDTLQFVCGDRGFF N+ LCGS LV+ L VCG+RGFF 818 gi|322793248|gb|EFZ16905.1| EFZ16905 hypothetical protein SINV_13149, partial [Solenopsis invicta] 13686 Solenopsis invicta 115 1 36.965 84 0.263357 18 23 10 45 21 61 41 5 ICSLYQLENYCNFVNQH-----LCGSHLVEALYLVCGERGF LCSLYAADAQSNFRRSHIRMQKLCSRKLSDALYLICRERGY +CSLY + NF H LC L +ALYL+C ERG+ 819 gi|32171965|sp|P01330.1|INS_MYOCO P01330 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 10157 Myocastor coypus 51 1 36.5798 83 0.288605 15 19 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YVSQRLCGSQLVDTLYSVCRHRGFY +V+Q LCGS LV+ LY VC RGF+ 820 gi|975132138|ref|XP_015282101.1| XP_015282101 PREDICTED: insulin-like [Gekko japonicus] 146911 Gekko japonicus gi|927028720|dbj|BAS32697.1| BAS32697 insulin [Gekko japonicus] 146911 Gekko japonicus 98 1 36.5798 83 0.331837 14 20 24 49 27 52 26 0 NQHLCGSHLVEALYLVCGERGFFXTP NYYLCGRQLVDSLNLICGDRGFYWGP N +LCG LV++L L+CG+RGF+ P 821 gi|751217549|ref|XP_011161773.1| XP_011161773 PREDICTED: insulin-like growth factor I isoform X2 [Solenopsis invicta] 13686 Solenopsis invicta 228 1 38.1206 87 0.360831 18 23 10 45 21 61 41 5 ICSLYQLENYCNFVNQH-----LCGSHLVEALYLVCGERGF LCSLYAADAQSNFRRSHIRMQKLCSRKLSDALYLICRERGY +CSLY + NF H LC L +ALYL+C ERG+ 822 gi|1190375796|ref|XP_020838017.1| XP_020838017 insulin-like growth factor I isoform X3 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 201 1 38.1206 87 0.378347 15 20 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 823 gi|612051226|ref|XP_007503392.1| XP_007503392 PREDICTED: insulin-like growth factor I isoform X3 [Monodelphis domestica] 13616 Monodelphis domestica 201 1 37.7354 86 0.385888 15 20 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 824 gi|32171968|sp|P01331.1|INS_PROGU P01331 RecName: Full=Insulin; Contains: RecName: Full=Insulin B chain; Contains: RecName: Full=Insulin A chain 10163 Proechimys guairae 50 1 36.1946 82 0.416565 15 18 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YVGQRLCGSQLVDTLYSVCKHRGFY +V Q LCGS LV+ LY VC RGF+ 825 gi|1311694|gb|AAB36057.1| AAB36057 insulin A-chain [Lampetra fluviatilis=river lamprey, pancreatic tissues, Peptide, 21 aa] 7748 Lampetra fluviatilis 21 1 35.8094 81 0.440235 15 17 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHRKCSIYDMENYCN GIVEQCC CS+Y +ENYCN 826 gi|60672478|gb|AAX33345.1| AAX33345 insulin, partial [Hoplomys gymnurus] 176501 Hoplomys gymnurus 52 1 35.8094 81 0.492165 15 18 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF YVGQRLCGSQLVDTLYSVCRHRGFY +V Q LCGS LV+ LY VC RGF+ 827 gi|808863458|gb|KKF14784.1| KKF14784 Insulin [Larimichthys crocea] 215358 Larimichthys crocea 148 1 36.965 84 0.506705 16 18 25 48 75 98 24 0 QHLCGSHLVEALYLVCGERGFFXT QQICGSDLVDALMLVCGPRGFSFT Q +CGS LV+AL LVCG RGF T 828 gi|1270554183|gb|ATP01242.1| ATP01242 insulin-like growth factor 1 [Iguana iguana] 8517 Iguana iguana 131 1 36.5798 83 0.515397 17 23 10 46 14 50 37 0 ICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF LCFLYLTSSSAAAGPETLCGAELVDALQFVCGERGFY +C LY + + LCG+ LV+AL VCGERGF+ 829 gi|1069374312|ref|XP_018081834.1| XP_018081834 PREDICTED: insulin-like [Xenopus laevis] 8355 Xenopus laevis gi|1050370877|gb|OCT73078.1| OCT73078 hypothetical protein XELAEV_18036057mg [Xenopus laevis] 8355 Xenopus laevis 100 1 35.8094 81 0.605031 16 18 27 49 30 52 23 0 LCGSHLVEALYLVCGERGFFXTP LCGLHLVEALLLVCEGRGFYYSP LCG HLVEAL LVC RGF+ +P 830 gi|208431|gb|AAA72202.1| AAA72202 insulin-like growth factor, partial [synthetic construct] 32630 synthetic construct 70 1 35.8094 81 0.637885 15 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT QALCGAELVDALQFVCGDRGFYFNKPT Q LCG+ LV+AL VCG+RGF+ T 831 gi|597774975|ref|XP_007251193.1| XP_007251193 insulin-like [Astyanax mexicanus] 7994 Astyanax mexicanus gi|1249038173|ref|XP_022533244.1| XP_022533244 insulin-like [Astyanax mexicanus] 7994 Astyanax mexicanus 109 1 35.8094 81 0.721831 16 18 21 49 22 50 29 0 NFVNQHLCGSHLVEALYLVCGERGFFXTP GFGTRRLCGIQLVEALLFVCGEKGVFYQP F + LCG LVEAL VCGE+G F P 832 gi|1190375804|ref|XP_020838021.1| XP_020838021 insulin-like growth factor I isoform X7 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 178 1 36.965 84 0.726106 15 19 25 48 51 74 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGAELVDALQFVCGERGFYFT + LCG+ LV+AL VCGERGF+ T 833 gnl|mdb|bmrb4832:1 bmrb4832:1 PROTEIN (GROWTH FACTOR IGF-1) 57 1 35.4242 80 0.772762 15 18 25 46 3 24 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVEALQFVCGERGFY + LCG+ LVEAL VCGERGF+ 834 gi|1326170423|ref|XP_012406055.2| XP_012406055 insulin-like growth factor I isoform X4 [Sarcophilus harrisii] 9305 Sarcophilus harrisii 167 1 36.5798 83 0.784042 15 20 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 835 gnl|mdb|bmrb4278:1 bmrb4278:1 IGF-I 83 1 35.4242 80 0.819865 16 21 22 46 11 37 27 2 FVN--QHLCGSHLVEALYLVCGERGFF FVNGPETLCGAELVDALQFVCGDRGFY FVN + LCG+ LV+AL VCG+RGF+ 836 gi|688543901|ref|XP_009297891.1| XP_009297891 LOW QUALITY PROTEIN: insulin-like [Danio rerio] 7955 Danio rerio 112 1 35.4242 80 0.884915 15 18 24 49 25 50 26 0 NQHLCGSHLVEALYLVCGERGFFXTP KRRLCGIQLVEALLIVCGEKGLFHQP + LCG LVEAL +VCGE+G F P 837 gnl|mdb|bmrb4069:1 bmrb4069:1 Long-[Arg-3]-Insulin-Like Growth Factor-I 83 1 35.4242 80 0.886073 17 22 22 51 11 42 32 2 FVN--QHLCGSHLVEALYLVCGERGFFXTPXT FVNGPRTLCGAELVDALQFVCGDRGFYFNKPT FVN + LCG+ LV+AL VCG+RGF+ T 838 gnl|mdb|bmrb4494:1 bmrb4494:1 IGF-I 83 1 35.4242 80 0.886073 17 22 22 51 11 42 32 2 FVN--QHLCGSHLVEALYLVCGERGFFXTPXT FVNGPRTLCGAELVDALQFVCGDRGFYFNKPT FVN + LCG+ LV+AL VCG+RGF+ T 839 gi|253723329|pdb|3LRI|A 3LRI_A Chain A, Solution structure and backbone dynamics of long-[Arg(3)]insulin-like growth factor-I 9606 Homo sapiens 83 1 35.4242 80 0.903451 17 22 22 51 11 42 32 2 FVN--QHLCGSHLVEALYLVCGERGFFXTPXT FVNGPRTLCGAELVDALQFVCGDRGFYFNKPT FVN + LCG+ LV+AL VCG+RGF+ T 840 gi|13646958|dbj|BAB41098.1| BAB41098 insulin like growth factor I, partial [Cynops pyrrhogaster] 8330 Cynops pyrrhogaster 72 1 35.039 79 0.908565 14 21 24 51 31 58 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SETLCGAELVDALQFVCGDRGFYFSKAT ++ LCG+ LV+AL VCG+RGF+ + T 841 gi|480542382|gb|AGJ91142.1| AGJ91142 insulin-like growth factor 1, partial [Chelydra serpentina] 8475 Chelydra serpentina 132 1 35.8094 81 0.91461 17 23 13 51 29 67 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSATAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 842 gi|528760405|gb|EPY80064.1| EPY80064 hypothetical protein CB1_000871002 [Camelus ferus] 419612 Camelus ferus 332 1 37.3502 85 0.942617 14 19 25 48 65 88 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGAELVDALQFVCGDRGFYFT + LCG+ LV+AL VCG+RGF+ T 843 gi|1190375792|ref|XP_020838015.1| XP_020838015 insulin-like growth factor I isoform X1 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 224 1 36.965 84 0.969457 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 844 gi|612051222|ref|XP_007503390.1| XP_007503390 PREDICTED: insulin-like growth factor I isoform X1 [Monodelphis domestica] 13616 Monodelphis domestica 224 1 36.965 84 1.01738 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 845 gi|698400372|ref|XP_009808638.1| XP_009808638 PREDICTED: insulin-like growth factor I [Gavia stellata] 37040 Gavia stellata 88 1 35.039 79 1.03271 14 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFSKST + LCG+ LV+AL VCG+RGF+ + T 846 gi|124365|sp|P22334.1|ILP_BRACL P22334 RecName: Full=Insulin-like peptide; Contains: RecName: Full=Insulin-like peptide B chain; Contains: RecName: Full=Insulin-like peptide A chain; Flags: Precursor 7738 Branchiostoma californiense gi|156051|gb|AAA62720.1| AAA62720 insulin-like peptide [Branchiostoma californiense] 7738 Branchiostoma californiense 305 1 36.965 84 1.05591 12 17 1 21 81 101 21 0 GIVEQCCTSICSLYQLENYCN GLVEECCYNVCDYSQLESYCN G+VE+CC ++C QLE+YCN 847 gi|704248778|ref|XP_010147206.1| XP_010147206 PREDICTED: insulin-like growth factor I, partial [Eurypyga helias] 54383 Eurypyga helias 87 1 35.039 79 1.08873 14 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFSKST + LCG+ LV+AL VCG+RGF+ + T 848 gi|1337272932|gb|POI31264.1| POI31264 hypothetical protein CIB84_004984 [Bambusicola thoracicus] 9083 Bambusicola thoracica 82 1 35.039 79 1.09207 14 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFSKST + LCG+ LV+AL VCG+RGF+ + T 849 gi|18542389|gb|AAL75568.1|AF467543_1 AAL75568 insulin-like growth factor 1, partial [Trichosurus vulpecula] 9337 Trichosurus vulpecula 86 1 35.039 79 1.14791 15 20 25 51 42 68 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 850 gi|1212374723|ref|XP_021531232.1| XP_021531232 insulin-like growth factor I isoform X2 [Aotus nancymaae] 37293 Aotus nancymaae 178 1 36.1946 82 1.15229 15 19 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFNKPT + LCG+ LV+AL VCGERGF+ T 851 gi|821487009|ref|XP_012406057.1| XP_012406057 insulin-like growth factor I isoform X1 [Sarcophilus harrisii] 9305 Sarcophilus harrisii 224 1 36.5798 83 1.16444 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 852 gi|751217545|ref|XP_011161771.1| XP_011161771 PREDICTED: insulin-like growth factor I isoform X1 [Solenopsis invicta] 13686 Solenopsis invicta gi|751217547|ref|XP_011161772.1| XP_011161772 PREDICTED: insulin-like growth factor I isoform X1 [Solenopsis invicta] 13686 Solenopsis invicta 230 1 36.5798 83 1.17062 18 23 10 45 21 61 41 5 ICSLYQLENYCNFVNQH-----LCGSHLVEALYLVCGERGF LCSLYAADAQSNFRRSHIRMQKLCSRKLSDALYLICRERGY +CSLY + NF H LC L +ALYL+C ERG+ 853 gi|344252374|gb|EGW08478.1| EGW08478 Insulin-like growth factor II [Cricetulus griseus] 10029 Cricetulus griseus 155 1 35.8094 81 1.23717 13 18 24 49 49 74 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SETLCGGELVDTLQFVCSDRGFYFTP ++ LCG LV+ L VC +RGF+ TP 854 gi|298105645|gb|ADI55319.1| ADI55319 insulin-like growth factor 1, partial [Trichosurus vulpecula] 9337 Trichosurus vulpecula 116 1 35.4242 80 1.25464 15 20 25 51 42 68 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 855 gi|260797601|ref|XP_002593790.1| XP_002593790 hypothetical protein BRAFLDRAFT_121099 [Branchiostoma floridae] 7739 Branchiostoma floridae gi|229279020|gb|EEN49801.1| EEN49801 hypothetical protein BRAFLDRAFT_121099 [Branchiostoma floridae] 7739 Branchiostoma floridae 417 1 36.965 84 1.25744 12 17 1 21 207 227 21 0 GIVEQCCTSICSLYQLENYCN GLVEECCYNVCDYSQLESYCN G+VE+CC ++C QLE+YCN 856 gi|1586108|prf||2203282A 2203282A insulin:SUBUNIT=A chain 71168 Geotria australis 21 1 34.6538 78 1.32923 14 19 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEKCCHNRCSIYQMESYCN GIVE+CC + CS+YQ+E+YCN 857 gi|22830883|dbj|BAC15764.1| BAC15764 Insulin-like growth factor precursor [Petromyzon marinus] 7757 Petromyzon marinus 132 1 35.4242 80 1.33583 14 19 23 46 54 77 24 0 VNQHLCGSHLVEALYLVCGERGFF ASETLCGSELVDALQFVCGDRGFY ++ LCGS LV+AL VCG+RGF+ 858 gi|725572126|ref|XP_010338528.1| XP_010338528 PREDICTED: insulin-like growth factor I isoform X2 [Saimiri boliviensis boliviensis] 39432 Saimiri boliviensis boliviensis 185 1 36.1946 82 1.34788 15 19 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFNKPT + LCG+ LV+AL VCGERGF+ T 859 gi|1043417154|gb|OCA29786.1| OCA29786 hypothetical protein XENTR_v90019210mg [Xenopus tropicalis] 8364 Xenopus (Silurana) tropicalis 100 1 35.039 79 1.35142 16 17 25 49 28 52 25 0 QHLCGSHLVEALYLVCGERGFFXTP HRLCGLHLVEALLLVCEGRGFYYRP LCG HLVEAL LVC RGF+ P 860 gi|612051224|ref|XP_007503391.1| XP_007503391 PREDICTED: insulin-like growth factor I isoform X2 [Monodelphis domestica] 13616 Monodelphis domestica 210 1 36.1946 82 1.44714 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 861 gi|591356056|ref|XP_007072330.1| XP_007072330 PREDICTED: insulin-like growth factor I [Chelonia mydas] 8469 Chelonia mydas 153 1 35.8094 81 1.46555 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSATAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 862 gi|1190375808|ref|XP_020838023.1| XP_020838023 insulin-like growth factor I isoform X9 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 153 1 35.8094 81 1.48078 15 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGERGFYFSKPT LCG+ LV+AL VCGERGF+ + T 863 gi|821487007|ref|XP_012406056.1| XP_012406056 insulin-like growth factor I isoform X5 [Sarcophilus harrisii] 9305 Sarcophilus harrisii 153 1 35.8094 81 1.49617 15 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGERGFYFSKPT LCG+ LV+AL VCGERGF+ + T 864 gi|612051232|ref|XP_007503395.1| XP_007503395 PREDICTED: insulin-like growth factor I isoform X6 [Monodelphis domestica] 13616 Monodelphis domestica 153 1 35.8094 81 1.49617 15 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGERGFYFSKPT LCG+ LV+AL VCGERGF+ + T 865 gi|215433750|gb|ACJ66734.1| ACJ66734 insulin-like growth factor-1, partial [Notamacropus eugenii] 9315 Macropus eugenii 153 1 35.8094 81 1.51171 15 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGERGFYFSKPT LCG+ LV+AL VCGERGF+ + T 866 gi|530633432|ref|XP_005303753.1| XP_005303753 insulin-like growth factor I [Chrysemys picta bellii] 8478 Chrysemys picta bellii gi|1351559920|ref|XP_024063921.1| XP_024063921 insulin-like growth factor I [Terrapene mexicana triunguis] 1415176 Terrapene mexicana triunguis 153 1 35.8094 81 1.52741 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSATAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 867 gi|558515915|ref|NP_001273849.1| NP_001273849 insulin-like growth factor I [Pelodiscus sinensis] 13735 Pelodiscus sinensis gi|356484679|gb|AET11881.1| AET11881 insulin-like growth factor-1 [Pelodiscus sinensis] 13735 Pelodiscus sinensis 153 1 35.8094 81 1.52741 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSATAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 868 gi|594622375|ref|XP_007165843.1| XP_007165843 PREDICTED: insulin-like growth factor I isoform X2 [Balaenoptera acutorostrata scammoni] 310752 Balaenoptera acutorostrata scammoni 171 1 35.8094 81 1.59753 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 869 gi|213447|gb|AAA49415.1| AAA49415 preproinsulin, partial [Oncorhynchus keta] 8018 Oncorhynchus keta gi|225447|prf||1303322B 1303322B insulin 8018 Oncorhynchus keta 66 1 34.6538 78 1.60113 13 17 1 21 46 66 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHKPCNIFDLQNYCN GIVEQCC C+++ L+NYCN 870 gi|1214035119|ref|XP_021570239.1| XP_021570239 insulin-like growth factor I isoform X2 [Carlito syrichta] 1868482 Carlito syrichta 193 1 36.1946 82 1.63431 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 871 gi|625212388|ref|XP_007646915.1| XP_007646915 PREDICTED: LOW QUALITY PROTEIN: insulin-like growth factor II isoform X1 [Cricetulus griseus] 10029 Cricetulus griseus 188 1 35.8094 81 1.71143 13 18 24 49 82 107 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SETLCGGELVDTLQFVCSDRGFYFTP ++ LCG LV+ L VC +RGF+ TP 872 gi|213465|gb|AAA72357.1| AAA72357 unnamed protein product, partial [Oncorhynchus keta] 8018 Oncorhynchus keta 55 1 34.2686 77 1.7782 13 17 1 21 35 55 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHKPCNIFDLQNYCN GIVEQCC C+++ L+NYCN 873 gi|1043417153|gb|OCA29785.1| OCA29785 hypothetical protein XENTR_v90019210mg, partial [Xenopus tropicalis] 8364 Xenopus (Silurana) tropicalis 137 1 35.4242 80 1.7893 16 17 27 49 67 89 23 0 LCGSHLVEALYLVCGERGFFXTP LCGLHLVEALLLVCEGRGFYYRP LCG HLVEAL LVC RGF+ P 874 gi|849982755|gb|AKN46138.1| AKN46138 insulin-like protein isoform 3 ILP3 [Desmognathus ocoee] 179530 Desmognathus ocoee 105 1 34.6538 78 1.87173 14 16 22 46 24 48 25 0 FVNQHLCGSHLVEALYLVCGERGFF FFGQPLCGDDLVMTLYFVCADRGFY F Q LCG LV LY VC +RGF+ 875 gi|593751348|ref|XP_007130865.1| XP_007130865 insulin-like growth factor I isoform X3 [Physeter catodon] 9755 Physeter catodon 170 1 35.8094 81 1.89654 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 876 gi|213449|gb|AAA49416.1| AAA49416 preproinsulin, partial [Oncorhynchus keta] 8018 Oncorhynchus keta 53 1 34.2686 77 1.90629 13 17 1 21 33 53 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHKPCNIFDLQNYCN GIVEQCC C+++ L+NYCN 877 gi|1190375798|ref|XP_020838018.1| XP_020838018 insulin-like growth factor I isoform X4 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 190 1 35.8094 81 1.93231 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 878 gi|58145|emb|CAA28759.1| CAA28759 unnamed protein product [synthetic construct] 32630 synthetic construct 137 1 35.039 79 1.94603 20 28 8 51 51 96 46 2 TSICSLY-QLENYCNFVN-QHLCGSHLVEALYLVCGERGFFXTPXT SQIVSFYFKLEVKHEFMGPETLCGAELVDALQFVCGDRGFYFNKPT + I S Y +LE F+ + LCG+ LV+AL VCG+RGF+ T 879 gi|1113760537|ref|XP_019345230.1| XP_019345230 PREDICTED: insulin-like growth factor I isoform X2 [Alligator mississippiensis] 8496 Alligator mississippiensis 139 1 35.039 79 1.96706 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 880 gi|675682713|ref|XP_009002742.1| XP_009002742 PREDICTED: insulin-like growth factor I isoform X3 [Callithrix jacchus] 9483 Callithrix jacchus gi|1044341408|ref|XP_017372330.1| XP_017372330 PREDICTED: insulin-like growth factor I isoform X2 [Cebus capucinus imitator] 1737458 Cebus capucinus imitator gi|1212374727|ref|XP_021531234.1| XP_021531234 insulin-like growth factor I isoform X4 [Aotus nancymaae] 37293 Aotus nancymaae 130 1 35.039 79 1.96868 15 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGERGFYFNKPT LCG+ LV+AL VCGERGF+ T 881 gi|752896764|ref|XP_011266655.1| XP_011266655 PREDICTED: insulin-like growth factor I isoform X1 [Camponotus floridanus] 104421 Camponotus floridanus gi|307167790|gb|EFN61235.1| EFN61235 Insulin [Camponotus floridanus] 104421 Camponotus floridanus 223 1 36.1946 82 1.98803 13 15 1 20 81 100 20 0 GIVEQCCTSICSLYQLENYC GLVEECCYHSCSYYQLERYC G+VE+CC CS YQLE YC 882 gi|928154250|ref|XP_013974708.1| XP_013974708 insulin-like growth factor I isoform X1 [Canis lupus familiaris] 9615 Canis lupus familiaris 171 1 35.8094 81 1.99321 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 883 gi|9973400|sp|Q28933.1|IGF1_SUNMU Q28933 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 9378 Suncus murinus gi|1304229|dbj|BAA07897.1| BAA07897 insulin-like growth factor I precursor, partial [Suncus murinus] 9378 Suncus murinus 81 1 34.2686 77 2.0062 14 19 25 51 7 33 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 884 gi|725572129|ref|XP_010338529.1| XP_010338529 PREDICTED: insulin-like growth factor I isoform X4 [Saimiri boliviensis boliviensis] 39432 Saimiri boliviensis boliviensis 130 1 35.039 79 2.03187 15 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGERGFYFNKPT LCG+ LV+AL VCGERGF+ T 885 gi|974070101|ref|XP_015232668.1| XP_015232668 PREDICTED: insulin-like [Cyprinodon variegatus] 28743 Cyprinodon variegatus 68 1 34.2686 77 2.05102 14 16 1 21 48 68 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHRPCSINHLEDYCN GIVEQCC CS+ LE+YCN 886 gi|281337860|gb|EFB13444.1| EFB13444 hypothetical protein PANDA_003502, partial [Ailuropoda melanoleuca] 9646 Ailuropoda melanoleuca 169 1 35.4242 80 2.07725 14 19 25 51 33 59 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 887 gi|1018988033|ref|XP_007668204.2| XP_007668204 PREDICTED: insulin-like growth factor I isoform X3 [Ornithorhynchus anatinus] 9258 Ornithorhynchus anatinus 139 1 35.039 79 2.11673 16 24 13 51 16 54 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTSSATAGSETLCGAELVDALQFVCGDRGFYFSKPT L L + ++ LCG+ LV+AL VCG+RGF+ + T 888 gi|655741594|ref|XP_008254939.1| XP_008254939 PREDICTED: insulin-like growth factor I isoform X2 [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 171 1 35.4242 80 2.117 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 889 gi|478487389|ref|XP_004418088.1| XP_004418088 PREDICTED: insulin-like growth factor I isoform X2 [Ceratotherium simum simum] 73337 Ceratotherium simum simum 171 1 35.4242 80 2.117 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 890 gi|738555|prf||2001274B 2001274B insulin-like growth factor I 9940 Ovis aries 70 1 34.2686 77 2.14708 14 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 891 gi|146446|gb|AAA53535.1| AAA53535 insulin-like growth factor I, partial [synthetic construct] 32630 synthetic construct 70 1 34.2686 77 2.14708 14 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 892 gi|1131277574|ref|XP_019816745.1| XP_019816745 PREDICTED: insulin-like growth factor I isoform X4 [Bos indicus] 9915 Bos indicus 171 1 35.4242 80 2.15993 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 893 gi|555973351|ref|XP_005898672.1| XP_005898672 PREDICTED: insulin-like growth factor I isoform X4 [Bos mutus] 72004 Bos mutus gi|742176918|ref|XP_010851729.1| XP_010851729 PREDICTED: insulin-like growth factor I isoform X4 [Bison bison bison] 43346 Bison bison bison gi|982925531|ref|XP_015326550.1| XP_015326550 insulin-like growth factor I isoform X4 [Bos taurus] 9913 Bos taurus 171 1 35.4242 80 2.15993 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 894 gi|1131277570|ref|XP_019816744.1| XP_019816744 PREDICTED: insulin-like growth factor I isoform X3 [Bos indicus] 9915 Bos indicus 172 1 35.4242 80 2.17977 14 19 25 51 36 62 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 895 gi|444731226|gb|ELW71586.1| ELW71586 Insulin-like growth factor I [Tupaia chinensis] 246437 Tupaia chinensis 182 1 35.8094 81 2.1841 14 20 25 51 25 51 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFSKPT + LCG+ LV+AL VCG+RGF+ + T 896 gi|555973349|ref|XP_005898671.1| XP_005898671 PREDICTED: insulin-like growth factor I isoform X3 [Bos mutus] 72004 Bos mutus gi|742176916|ref|XP_010851728.1| XP_010851728 PREDICTED: insulin-like growth factor I isoform X3 [Bison bison bison] 43346 Bison bison bison gi|982925528|ref|XP_015326549.1| XP_015326549 insulin-like growth factor I isoform X3 [Bos taurus] 9913 Bos taurus gi|326703753|gb|AEA06510.1| AEA06510 insulin-like growth factor I variant 4 [Bos taurus] 9913 Bos taurus 172 1 35.4242 80 2.20172 14 19 25 51 36 62 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 897 gi|1123948042|ref|XP_019587742.1| XP_019587742 PREDICTED: insulin-like growth factor I isoform X2 [Rhinolophus sinicus] 89399 Rhinolophus sinicus 171 1 35.4242 80 2.22595 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 898 gi|594069959|ref|XP_006058872.1| XP_006058872 PREDICTED: insulin-like growth factor I isoform X4 [Bubalus bubalis] 89462 Bubalus bubalis 171 1 35.4242 80 2.22595 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 899 gi|556779592|ref|XP_005984845.1| XP_005984845 PREDICTED: insulin-like growth factor I isoform X4 [Pantholops hodgsonii] 59538 Pantholops hodgsonii 171 1 35.4242 80 2.22595 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 900 gi|472387801|ref|XP_004413237.1| XP_004413237 PREDICTED: insulin-like growth factor I isoform X2 [Odobenus rosmarus divergens] 9708 Odobenus rosmarus divergens 171 1 35.4242 80 2.22595 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 901 gi|679201095|gb|KFW89157.1| KFW89157 Insulin-like growth factor I, partial [Phalacrocorax carbo] 9209 Phalacrocorax carbo 114 1 34.6538 78 2.22817 14 19 27 51 33 57 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 902 gi|392358091|gb|AFM73286.1| AFM73286 insulin-like growth factor 1, partial [Pantherophis guttatus] 94885 Pantherophis guttatus 144 1 35.039 79 2.23668 14 18 24 46 52 74 23 0 NQHLCGSHLVEALYLVCGERGFF QETLCGAELVDALQFVCGERGFY + LCG+ LV+AL VCGERGF+ 903 gi|594069957|ref|XP_006058871.1| XP_006058871 PREDICTED: insulin-like growth factor I isoform X3 [Bubalus bubalis] 89462 Bubalus bubalis 172 1 35.4242 80 2.24628 14 19 25 51 36 62 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 904 gi|821487003|ref|XP_012406054.1| XP_012406054 insulin-like growth factor I isoform X2 [Sarcophilus harrisii] 9305 Sarcophilus harrisii 190 1 35.8094 81 2.26075 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 905 gi|556779590|ref|XP_005984844.1| XP_005984844 PREDICTED: insulin-like growth factor I isoform X3 [Pantholops hodgsonii] 59538 Pantholops hodgsonii 172 1 35.4242 80 2.2689 14 19 25 51 36 62 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 906 gi|15826518|pdb|1IMX|A 1IMX_A Chain A, 1.8 Angstrom Crystal Structure Of Igf-1 9606 Homo sapiens gi|21465572|pdb|1H59|A 1H59_A Chain A, Complex Of Igfbp-5 With Igf-I 9606 Homo sapiens gi|22218687|pdb|1GZR|B 1GZR_B Chain B, Human Insulin-Like Growth Factor; Esrf Data 9606 Homo sapiens gi|22218695|pdb|1GZY|B 1GZY_B Chain B, Human Insulin-Like Growth Factor; In-House Data 9606 Homo sapiens gi|22218696|pdb|1GZZ|B 1GZZ_B Chain B, Human Insulin-Like Growth Factor; Hamburg Data 9606 Homo sapiens gi|22218697|pdb|1H02|B 1H02_B Chain B, Human Insulin-Like Growth Factor; Srs Daresbury Data 9606 Homo sapiens gi|61680230|pdb|1WQJ|I 1WQJ_I Chain I, Structural Basis For The Regulation Of Insulin-like Growth Factors (igfs) By Igf Binding Proteins (igfbps) 9606 Homo sapiens gi|114793742|pdb|2DSP|I 2DSP_I Chain I, Structural Basis For The Inhibition Of Insulin-Like Growth Factors By Igf Binding Proteins 9606 Homo sapiens gi|114793744|pdb|2DSQ|I 2DSQ_I Chain I, Structural Basis For The Inhibition Of Insulin-Like Growth Factors By Igf Binding Proteins 9606 Homo sapiens gi|114793746|pdb|2DSQ|C 2DSQ_C Chain C, Structural Basis For The Inhibition Of Insulin-Like Growth Factors By Igf Binding Proteins 9606 Homo sapiens gi|114793751|pdb|2DSR|I 2DSR_I Chain I, Structural Basis For The Inhibition Of Insulin-Like Growth Factors By Igf Binding Proteins 9606 Homo sapiens gi|157830440|pdb|1BQT|A 1BQT_A Chain A, THREE-DIMENSIONAL STRUCTURE OF HUMAN INSULIN-LIKE GROWTH FACTOR-I (IGF-I) DETERMINED BY 1H-NMR AND DISTANCE GEOMETRY, 6 STRUCTURES 9606 Homo sapiens gi|159162841|pdb|1PMX|A 1PMX_A Chain A, INSULIN-LIKE GROWTH FACTOR-I BOUND TO A PHAGE-DERIVED PEPTIDE 9606 Homo sapiens gi|159164584|pdb|2GF1|A 2GF1_A Chain A, SOLUTION STRUCTURE OF HUMAN INSULIN-LIKE GROWTH FACTOR 1: A NUCLEAR MAGNETIC RESONANCE AND RESTRAINED MOLECULAR DYNAMICS STUDY 9606 Homo sapiens gi|159164874|pdb|3GF1|A 3GF1_A Chain A, SOLUTION STRUCTURE OF HUMAN INSULIN-LIKE GROWTH FACTOR 1: A NUCLEAR MAGNETIC RESONANCE AND RESTRAINED MOLECULAR DYNAMICS STUDY 9606 Homo sapiens gi|829581713|pdb|4XSS|B 4XSS_B Chain B, Insulin-like Growth Factor I In Complex With Site 1 Of A Hybrid Insulin Receptor / Type 1 Insulin-like Growth Factor Receptor 9606 Homo sapiens gi|1351638484|pdb|5U8Q|B 5U8Q_B Chain B, Structure of the ectodomain of the human Type 1 insulin-like growth factor receptor in complex with IGF-I 9606 Homo sapiens gi|4261909|gb|AAD14209.1|S76122_1 AAD14209 insulin-like growth factor 1, partial [Bos taurus] 9913 Bos taurus gi|208427|gb|AAA72204.1| AAA72204 insulin-like growth factor, partial [synthetic construct] 32630 synthetic construct gi|1159332353|gb|AQY61797.1| AQY61797 insulin-like growth factor I, partial [Homo sapiens] 9606 Homo sapiens gi|223813|prf||0912651A 0912651A somatomedin C 9606 Homo sapiens 70 1 33.8834 76 2.29696 14 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 907 gnl|mdb|bmrb4204:1 bmrb4204:1 Insulin-like growth factor-I (Somatomedin C) 70 1 33.8834 76 2.29696 14 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 908 gnl|mdb|bmrb15654:1 bmrb15654:1 Insulin-like_growth_factor-I_(IGF-I) 70 1 33.8834 76 2.29696 14 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 909 gnl|mdb|bmrb2498:1 bmrb2498:1 insulin-like growth factor-I 70 1 33.8834 76 2.29696 14 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 910 gi|224061|prf||1009206A 1009206A somatomedin A 9606 Homo sapiens 69 1 33.8834 76 2.31064 13 18 25 46 3 24 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 911 gi|545205793|ref|XP_005606527.1| XP_005606527 insulin-like growth factor I isoform X2 [Equus caballus] 9796 Equus caballus gi|664717734|ref|XP_008515870.1| XP_008515870 PREDICTED: insulin-like growth factor I isoform X2 [Equus przewalskii] 9798 Equus przewalskii 171 1 35.4242 80 2.31707 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 912 gi|505777616|ref|XP_004602832.1| XP_004602832 PREDICTED: insulin-like growth factor I isoform X4 [Sorex araneus] 42254 Sorex araneus 176 1 35.4242 80 2.32497 14 19 25 51 74 100 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 913 gi|208526|gb|AAA72579.1| AAA72579 insulin-like growth factor [synthetic construct] 32630 synthetic construct gi|208675|gb|AAA72763.1| AAA72763 synthetic insulin-like growth factor [synthetic construct] 32630 synthetic construct gi|220973|dbj|BAA01200.1| BAA01200 Met-somatomedin C polypeptide [synthetic construct] 32630 synthetic construct 71 1 33.8834 76 2.32802 14 19 25 51 4 30 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 914 gi|738554|prf||2001274A 2001274A insulin-like growth factor I 39410 Odocoileus sp. 70 1 33.8834 76 2.34168 14 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 915 gi|1388875831|dbj|BBE01280.1| BBE01280 insulin-like growth factor 1, partial [Chrysiptera cyanea] 83874 Chrysiptera cyanea 155 1 35.4242 80 2.34235 13 18 25 48 17 40 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGAELVDTLQFVCGERGFYFS + LCG+ LV+ L VCGERGF+ + 916 gi|1121878745|ref|XP_019400297.1| XP_019400297 PREDICTED: insulin-like growth factor I isoform X2 [Crocodylus porosus] 8502 Crocodylus porosus 139 1 35.039 79 2.3504 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 917 gi|209366|gb|AAA72455.1| AAA72455 synthetic somatomedin-C/insulin-like growth factor I [synthetic construct] 32630 synthetic construct 71 1 33.8834 76 2.35059 14 19 25 51 4 30 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 918 gi|14571865|gb|AAK67296.1|AF282620_1 AAK67296 SIGF1-GFP fusion protein [synthetic construct] 32630 synthetic construct 526 1 36.5798 83 2.3639 14 19 25 51 163 189 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 919 gi|612051228|ref|XP_007503393.1| XP_007503393 PREDICTED: insulin-like growth factor I isoform X4 [Monodelphis domestica] 13616 Monodelphis domestica 190 1 35.4242 80 2.37429 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 920 gi|637300360|ref|XP_008108783.1| XP_008108783 PREDICTED: insulin-like growth factor I isoform X3 [Anolis carolinensis] 28377 Anolis carolinensis gi|637300363|ref|XP_008108784.1| XP_008108784 PREDICTED: insulin-like growth factor I isoform X3 [Anolis carolinensis] 28377 Anolis carolinensis 137 1 35.039 79 2.37529 14 19 24 48 51 75 25 0 NQHLCGSHLVEALYLVCGERGFFXT QETLCGAELVDALQFVCGERGFYFS + LCG+ LV+AL VCGERGF+ + 921 gi|227566|prf||1707201A 1707201A insulin-like growth factor 1 9825 Sus scrofa domesticus 70 1 33.8834 76 2.38727 14 18 26 51 4 29 26 0 HLCGSHLVEALYLVCGERGFFXTPXT ELCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 922 gi|392358087|gb|AFM73284.1| AFM73284 insulin-like growth factor 1, partial [Thamnophis elegans] 35005 Thamnophis elegans 157 1 35.4242 80 2.40013 14 19 25 48 55 78 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGAELVDALQFVCGERGFYFS + LCG+ LV+AL VCGERGF+ + 923 gi|706115695|ref|XP_010194475.1| XP_010194475 PREDICTED: insulin-like growth factor I [Colius striatus] 57412 Colius striatus gi|677084820|gb|KFP29405.1| KFP29405 Insulin-like growth factor I [Colius striatus] 57412 Colius striatus 153 1 35.039 79 2.40444 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 924 gi|676275958|gb|KFO30289.1| KFO30289 Insulin-like growth factor I [Fukomys damarensis] 885580 Fukomys damarensis 305 1 36.1946 82 2.42169 14 19 25 51 158 184 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 925 gi|205278400|gb|ACI02124.1| ACI02124 insulin-like growth factor I precursor, partial [Scophthalmus maximus] 52904 Scophthalmus maximus 70 1 33.8834 76 2.43376 14 19 25 51 3 29 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 926 gi|675318403|gb|KFM13665.1| KFM13665 Insulin-like growth factor I, partial [Aptenodytes forsteri] 9233 Aptenodytes forsteri gi|676815594|gb|KFP11499.1| KFP11499 Insulin-like growth factor I, partial [Egretta garzetta] 188379 Egretta garzetta gi|677375153|gb|KFQ00143.1| KFQ00143 Insulin-like growth factor I, partial [Haliaeetus albicilla] 8969 Haliaeetus albicilla gi|677455677|gb|KFQ45091.1| KFQ45091 Insulin-like growth factor I, partial [Nestor notabilis] 176057 Nestor notabilis gi|677473877|gb|KFQ63291.1| KFQ63291 Insulin-like growth factor I, partial [Pelecanus crispus] 36300 Pelecanus crispus gi|677535562|gb|KFQ97570.1| KFQ97570 Insulin-like growth factor I, partial [Nipponia nippon] 128390 Nipponia nippon gi|677540902|gb|KFR02429.1| KFR02429 Insulin-like growth factor I, partial [Opisthocomus hoazin] 30419 Opisthocomus hoazin gi|678121138|gb|KFU95786.1| KFU95786 Insulin-like growth factor I, partial [Chaetura pelagica] 8897 Chaetura pelagica gi|678216946|gb|KFV83925.1| KFV83925 Insulin-like growth factor I, partial [Struthio camelus australis] 441894 Struthio camelus australis gi|678989970|gb|KFV97315.1| KFV97315 Insulin-like growth factor I, partial [Fulmarus glacialis] 30455 Fulmarus glacialis gi|679146940|gb|KFW73454.1| KFW73454 Insulin-like growth factor I, partial [Pygoscelis adeliae] 9238 Pygoscelis adeliae gi|683467542|gb|KFZ61751.1| KFZ61751 Insulin-like growth factor I, partial [Antrostomus carolinensis] 279965 Caprimulgus carolinensis gi|697459717|gb|KGL95268.1| KGL95268 Insulin-like growth factor I, partial [Charadrius vociferus] 50402 Charadrius vociferus 114 1 34.2686 77 2.44828 14 19 27 51 33 57 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 927 gi|548466845|ref|XP_005680591.1| XP_005680591 PREDICTED: insulin-like growth factor I isoform X4 [Capra hircus] 9925 Capra hircus 171 1 35.4242 80 2.4855 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 928 gi|1020481027|ref|XP_016145967.1| XP_016145967 PREDICTED: insulin-like growth factor II isoform X2 [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 245 1 35.8094 81 2.48763 13 14 1 20 136 155 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCVRACDLQHLESYC GIVEQCC C L LE+YC 929 gi|336111780|gb|AEI16550.1| AEI16550 insulin-like growth factor II, partial [Chelon labrosus] 48171 Chelon labrosus 166 1 35.4242 80 2.49231 14 19 25 51 9 35 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDALQFVCGDRGFYFSRPT + LCG LV+AL VCG+RGF+ + T 930 gi|1020481025|ref|XP_016145966.1| XP_016145966 PREDICTED: insulin-like growth factor II isoform X1 [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 246 1 35.8094 81 2.49595 13 14 1 20 137 156 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCVRACDLQHLESYC GIVEQCC C L LE+YC 931 gi|1170570|sp|P41522.1|INS_ANGAN P41522 RecName: Full=Insulin; Contains: RecName: Full=Insulin A chain; Flags: Precursor 7936 Anguilla anguilla 53 1 33.8834 76 2.49805 13 17 1 21 33 53 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHKPCNIFDLQNYCN GIVEQCC C+++ L+NYCN 932 gi|958822282|ref|XP_014690511.1| XP_014690511 PREDICTED: insulin-like growth factor I isoform X2 [Equus asinus] 9793 Equus asinus 171 1 35.4242 80 2.51053 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 933 gi|1113760539|ref|XP_019345231.1| XP_019345231 PREDICTED: insulin-like growth factor I isoform X3 [Alligator mississippiensis] 8496 Alligator mississippiensis 139 1 35.039 79 2.52907 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 934 gi|548466843|ref|XP_005680590.1| XP_005680590 PREDICTED: insulin-like growth factor I isoform X3 [Capra hircus] 9925 Capra hircus 172 1 35.4242 80 2.53301 14 19 25 51 36 62 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 935 gi|1111117745|ref|XP_019302155.1| XP_019302155 PREDICTED: insulin-like growth factor I isoform X2 [Panthera pardus] 9691 Panthera pardus gi|1304915245|ref|XP_023113142.1| XP_023113142 insulin-like growth factor I isoform X1 [Felis catus] 9685 Felis catus 171 1 35.4242 80 2.5358 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 936 gi|957742296|gb|ALQ12262.1| ALQ12262 insulin-like growth factor-1 [Alligator sinensis] 38654 Alligator sinensis 153 1 35.039 79 2.55751 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 937 gi|511836956|ref|XP_004743051.1| XP_004743051 PREDICTED: insulin-like growth factor I isoform X2 [Mustela putorius furo] 9669 Mustela putorius furo 171 1 35.4242 80 2.56133 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 938 gi|558220649|ref|XP_006109582.1| XP_006109582 insulin [Myotis lucifugus] 59463 Myotis lucifugus 105 1 34.2686 77 2.57644 14 16 2 21 86 105 20 0 IVEQCCTSICSLYQLENYCN IVEVCCTNICSFYDMETYCN IVE CCT+ICS Y +E YCN 939 gi|483509427|gb|EOA99109.1| EOA99109 Insulin-like growth factor I, partial [Anas platyrhynchos] 8839 Anas platyrhynchos gi|676418151|gb|KFO61196.1| KFO61196 Insulin-like growth factor I, partial [Corvus brachyrhynchos] 85066 Corvus brachyrhynchos 114 1 34.2686 77 2.57993 14 19 27 51 33 57 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 940 gi|1121878742|ref|XP_019400296.1| XP_019400296 PREDICTED: insulin-like growth factor I isoform X1 [Crocodylus porosus] 8502 Crocodylus porosus 153 1 35.039 79 2.58394 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 941 gi|1246218087|ref|XP_022455542.1| XP_022455542 insulin-like growth factor I isoform X2 [Delphinapterus leucas] 9749 Delphinapterus leucas 170 1 35.4242 80 2.5896 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 942 gi|1176314687|ref|XP_020660089.1| XP_020660089 insulin-like growth factor I isoform X2 [Pogona vitticeps] 103695 Pogona vitticeps 143 1 35.039 79 2.60373 14 17 27 46 31 50 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGERGFY LCG+ LV+AL VCGERGF+ 943 gi|562823297|ref|XP_006141464.1| XP_006141464 PREDICTED: insulin-like growth factor I isoform X3 [Tupaia chinensis] 246437 Tupaia chinensis 143 1 35.039 79 2.63099 14 19 27 51 37 61 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 944 gi|927145112|ref|XP_013914328.1| XP_013914328 PREDICTED: insulin-like growth factor I [Thamnophis sirtalis] 35019 Thamnophis sirtalis 158 1 35.039 79 2.63539 14 19 25 48 44 67 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGAELVDALQFVCGERGFYFS + LCG+ LV+AL VCGERGF+ + 945 gi|558472762|ref|NP_001273775.1| NP_001273775 insulin-like growth factor I [Alligator sinensis] 38654 Alligator sinensis gi|564241015|ref|XP_006277331.1| XP_006277331 PREDICTED: insulin-like growth factor I isoform X1 [Alligator mississippiensis] 8496 Alligator mississippiensis gi|411012953|gb|AFV99133.1| AFV99133 insulin-like growth factor [Alligator sinensis] 38654 Alligator sinensis gi|1011592033|gb|KYO36460.1| KYO36460 insulin-like growth factor I [Alligator mississippiensis] 8496 Alligator mississippiensis 153 1 35.039 79 2.63763 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 946 gi|743733751|ref|XP_010961105.1| XP_010961105 PREDICTED: insulin-like growth factor I isoform X2 [Camelus bactrianus] 9837 Camelus bactrianus 171 1 35.4242 80 2.63945 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 947 gi|2289113|gb|AAB64356.1| AAB64356 proinsulin, partial [Callorhinchus milii] 7868 Callorhinchus milii 74 1 33.8834 76 2.64651 15 16 1 21 54 74 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHNTCSLVNLEGYCN GIVEQCC + CSL LE YCN 948 gi|927110537|ref|XP_013915109.1| XP_013915109 PREDICTED: insulin-like growth factor I, partial [Thamnophis sirtalis] 35019 Thamnophis sirtalis 150 1 35.039 79 2.67104 14 18 25 46 53 74 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGERGFY + LCG+ LV+AL VCGERGF+ 949 gi|1375012081|ref|XP_024435204.1| XP_024435204 insulin-like growth factor I isoform X2 [Desmodus rotundus] 9430 Desmodus rotundus 171 1 35.4242 80 2.69284 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 950 gi|821392960|ref|XP_012388351.1| XP_012388351 PREDICTED: insulin-like growth factor I isoform X2 [Orcinus orca] 9733 Orcinus orca 170 1 35.4242 80 2.69557 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 951 gi|283826482|gb|ADB43569.1| ADB43569 insulin-like growth factor I [Sus scrofa] 9823 Sus scrofa 171 1 35.4242 80 2.71993 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 952 gi|390468110|ref|XP_002752957.2| XP_002752957 PREDICTED: insulin-like growth factor I isoform X2 [Callithrix jacchus] 9483 Callithrix jacchus gi|1044341406|ref|XP_017372322.1| XP_017372322 PREDICTED: insulin-like growth factor I isoform X1 [Cebus capucinus imitator] 1737458 Cebus capucinus imitator gi|1212374725|ref|XP_021531233.1| XP_021531233 insulin-like growth factor I isoform X3 [Aotus nancymaae] 37293 Aotus nancymaae 153 1 35.039 79 2.72023 15 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFNKPT + LCG+ LV+AL VCGERGF+ T 953 gi|37181038|gb|AAQ88429.1| AAQ88429 bombyxin-IGF I fusion protein (BIGFI) [synthetic construct] 32630 synthetic construct 120 1 34.2686 77 2.73104 14 19 25 51 26 52 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 954 gi|379975560|gb|AFD20695.1| AFD20695 insulin-like growth factor I transcript variant 5 [Cervus elaphus] 9860 Cervus elaphus 172 1 35.4242 80 2.74396 14 19 25 51 36 62 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 955 gi|548466847|ref|XP_005680592.1| XP_005680592 PREDICTED: insulin-like growth factor I isoform X5 [Capra hircus] 9925 Capra hircus 164 1 35.039 79 2.75708 14 19 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 956 gi|1018988027|ref|XP_016083431.1| XP_016083431 PREDICTED: insulin-like growth factor I isoform X2 [Ornithorhynchus anatinus] 9258 Ornithorhynchus anatinus 153 1 35.039 79 2.77671 14 21 24 51 50 77 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SETLCGAELVDALQFVCGDRGFYFSKPT ++ LCG+ LV+AL VCG+RGF+ + T 957 gi|1117329730|ref|XP_019370907.1| XP_019370907 PREDICTED: insulin-like growth factor I isoform X2 [Gavialis gangeticus] 94835 Gavialis gangeticus 139 1 34.6538 78 2.77877 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 958 gi|632984542|ref|XP_007909191.1| XP_007909191 PREDICTED: insulin-like growth factor II isoform X1 [Callorhinchus milii] 7868 Callorhinchus milii 195 1 35.4242 80 2.80283 14 19 25 51 43 69 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT EMLCGSELVDTLQFVCGDRGFYFSRST + LCGS LV+ L VCG+RGF+ + T 959 gi|1378908133|ref|XP_024587961.1| XP_024587961 insulin-like growth factor I isoform X3 [Neophocaena asiaeorientalis asiaeorientalis] 1706337 Neophocaena asiaeorientalis asiaeorientalis 170 1 35.039 79 2.80583 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 960 gi|545828007|ref|XP_005664253.1| XP_005664253 insulin-like growth factor I isoform X2 [Sus scrofa] 9823 Sus scrofa 171 1 35.039 79 2.83101 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 961 gi|403275921|ref|XP_003929668.1| XP_003929668 PREDICTED: insulin-like growth factor I isoform X3 [Saimiri boliviensis boliviensis] 39432 Saimiri boliviensis boliviensis 153 1 35.039 79 2.83435 15 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFNKPT + LCG+ LV+AL VCGERGF+ T 962 gi|795095450|ref|XP_011790425.1| XP_011790425 PREDICTED: insulin-like growth factor I isoform X2 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus 192 1 35.4242 80 2.8654 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 963 gi|68165957|gb|AAY87932.1| AAY87932 insulin-like growth factor 1, partial [Bubalus bubalis] 89462 Bubalus bubalis 65 1 33.8834 76 2.8698 14 18 27 51 1 25 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 964 gi|678178478|gb|KFV46200.1| KFV46200 Insulin-like growth factor I, partial [Tyto alba] 56313 Tyto alba 133 1 34.6538 78 2.89651 14 19 27 51 33 57 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 965 gi|676731079|gb|KFO94023.1| KFO94023 Insulin-like growth factor I, partial [Buceros rhinoceros silvestris] 175836 Buceros rhinoceros silvestris 133 1 34.6538 78 2.89651 14 19 27 51 33 57 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 966 gi|452113835|gb|AGG09134.1| AGG09134 insulin-like growth factor 1 variant 2, partial [Bubalus bubalis] 89462 Bubalus bubalis gi|452113838|gb|AGG09136.1| AGG09136 insulin-like growth factor 1 variant 1, partial [Bubalus bubalis] 89462 Bubalus bubalis 113 1 34.2686 77 2.90919 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 967 gi|1708431|sp|P51462.1|IGF1_COTJA P51462 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 93934 Coturnix japonica 124 1 34.2686 77 2.9213 14 19 27 51 24 48 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 968 gi|562823299|ref|XP_006141465.1| XP_006141465 PREDICTED: insulin-like growth factor I isoform X4 [Tupaia chinensis] 246437 Tupaia chinensis 137 1 34.6538 78 2.96012 14 19 27 51 37 61 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 969 gi|1212374721|ref|XP_012324642.2| XP_012324642 insulin-like growth factor I isoform X1 [Aotus nancymaae] 37293 Aotus nancymaae 201 1 35.4242 80 2.97754 15 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFNKPT + LCG+ LV+AL VCGERGF+ T 970 gi|724963733|ref|XP_010355572.1| XP_010355572 PREDICTED: insulin-like growth factor I isoform X2 [Rhinopithecus roxellana] 61622 Rhinopithecus roxellana gi|1059185473|ref|XP_017748947.1| XP_017748947 PREDICTED: insulin-like growth factor I isoform X2 [Rhinopithecus bieti] 61621 Rhinopithecus bieti gi|1297583437|ref|XP_023044520.1| XP_023044520 insulin-like growth factor I isoform X2 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles gi|1297583443|ref|XP_023044602.1| XP_023044602 insulin-like growth factor I isoform X2 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles 192 1 35.4242 80 2.97948 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 971 gi|115607200|gb|ABJ16445.1| ABJ16445 insulin-like growth factor I, partial [Cervus elaphus] 9860 Cervus elaphus 116 1 34.2686 77 2.99178 13 18 25 46 33 54 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 972 gi|1994|emb|CAA35527.1| CAA35527 insulin like growth factor I (118 AA), partial [Sus scrofa] 9823 Sus scrofa 118 1 34.2686 77 2.99682 14 19 25 51 16 42 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 973 gi|640807815|ref|XP_008060413.1| XP_008060413 insulin-like growth factor I isoform X5 [Carlito syrichta] 1868482 Carlito syrichta 137 1 34.6538 78 3.0228 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 974 gi|1117329447|ref|XP_019370906.1| XP_019370906 PREDICTED: insulin-like growth factor I isoform X1 [Gavialis gangeticus] 94835 Gavialis gangeticus 153 1 35.039 79 3.04559 17 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLTNSAAAGPETLCGAELVDALQFVCGDRGFYFSKPT L L N + LCG+ LV+AL VCG+RGF+ + T 975 gi|4558029|pdb|1B9G|A 1B9G_A Chain A, Insulin-Like-Growth-Factor-1 9606 Homo sapiens 57 1 33.4982 75 3.07282 13 18 25 46 3 24 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 976 gi|676241218|gb|KFO05090.1| KFO05090 Insulin-like growth factor I, partial [Balearica regulorum gibbericeps] 100784 Balearica pavonina gibbericeps gi|676587519|gb|KFO75884.1| KFO75884 Insulin-like growth factor I, partial [Cuculus canorus] 55661 Cuculus canorus gi|676765453|gb|KFO95440.1| KFO95440 Insulin-like growth factor I, partial [Calypte anna] 9244 Calypte anna gi|677145989|gb|KFP40632.1| KFP40632 Insulin-like growth factor I, partial [Chlamydotis macqueenii] 187382 Chlamydotis undulata macqueenii gi|677240053|gb|KFP55158.1| KFP55158 Insulin-like growth factor I, partial [Cathartes aura] 43455 Cathartes aura gi|677401515|gb|KFQ15768.1| KFQ15768 Insulin-like growth factor I, partial [Leptosomus discolor] 188344 Leptosomus discolor gi|677436143|gb|KFQ34683.1| KFQ34683 Insulin-like growth factor I, partial [Merops nubicus] 57421 Merops nubicus gi|677485629|gb|KFQ75034.1| KFQ75034 Insulin-like growth factor I, partial [Phaethon lepturus] 97097 Phaethon lepturus gi|677501256|gb|KFQ89368.1| KFQ89368 Insulin-like growth factor I, partial [Phoenicopterus ruber ruber] 9218 Phoenicopterus ruber ruber gi|678197234|gb|KFV64216.1| KFV64216 Insulin-like growth factor I, partial [Picoides pubescens] 118200 Picoides pubescens gi|683467360|gb|KFZ61569.1| KFZ61569 Insulin-like growth factor I, partial [Podiceps cristatus] 345573 Podiceps cristatus gi|697424493|gb|KGL85493.1| KGL85493 Insulin-like growth factor I, partial [Tinamus guttatus] 94827 Tinamus guttatus 133 1 34.6538 78 3.08505 14 19 27 51 33 57 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 977 gi|1126247207|ref|XP_019651088.1| XP_019651088 PREDICTED: insulin-like growth factor I isoform X2 [Ailuropoda melanoleuca] 9646 Ailuropoda melanoleuca 173 1 35.039 79 3.08858 14 19 25 51 37 63 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 978 gi|831215174|ref|XP_012656735.1| XP_012656735 insulin-like growth factor I isoform X2 [Otolemur garnettii] 30611 Otolemur garnettii 137 1 34.6538 78 3.11929 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 979 gi|674049315|ref|XP_008830829.1| XP_008830829 PREDICTED: insulin-like growth factor I isoform X3 [Nannospalax galili] 1026970 Nannospalax galili 143 1 34.6538 78 3.14037 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 980 gi|507929115|ref|XP_004675805.1| XP_004675805 PREDICTED: insulin-like growth factor I isoform X3 [Condylura cristata] 143302 Condylura cristata 137 1 34.6538 78 3.15213 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 981 gi|635067657|ref|XP_008002632.1| XP_008002632 PREDICTED: insulin-like growth factor I isoform X2 [Chlorocebus sabaeus] 60711 Chlorocebus sabaeus gi|795311369|ref|XP_011824031.1| XP_011824031 PREDICTED: insulin-like growth factor I isoform X2 [Mandrillus leucophaeus] 9568 Mandrillus leucophaeus gi|795456332|ref|XP_011888069.1| XP_011888069 PREDICTED: insulin-like growth factor I isoform X2 [Cercocebus atys] 9531 Cercocebus atys 192 1 35.4242 80 3.1591 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 982 gi|1072259848|ref|XP_018415177.1| XP_018415177 PREDICTED: insulin-like growth factor I [Nanorana parkeri] 125878 Nanorana parkeri 153 1 35.039 79 3.17322 14 17 27 46 53 72 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFF LCG+ LV+AL VCG+RGFF 983 gi|1048405013|ref|XP_017536860.1| XP_017536860 PREDICTED: insulin-like growth factor I isoform X2 [Manis javanica] 9974 Manis javanica 171 1 35.039 79 3.22391 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 984 gi|1214020105|ref|XP_021564762.1| XP_021564762 insulin-like growth factor II, partial [Carlito syrichta] 1868482 Carlito syrichta 210 1 35.4242 80 3.22684 13 18 24 48 53 77 25 0 NQHLCGSHLVEALYLVCGERGFFXT SETLCGGELVDTLQFVCGDRGFYFT ++ LCG LV+ L VCG+RGF+ T 985 gi|1201820449|ref|XP_021243084.1| XP_021243084 insulin-like growth factor I isoform X2 [Numida meleagris] 8996 Numida meleagris 130 1 34.2686 77 3.22935 14 19 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 986 gi|667309746|ref|XP_008584171.1| XP_008584171 PREDICTED: insulin-like growth factor I isoform X3 [Galeopterus variegatus] 482537 Galeopterus variegatus 143 1 34.6538 78 3.23992 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 987 gi|188531704|gb|ACD62897.1| ACD62897 insulin-like growth factor I, partial [Cynoglossus semilaevis] 244447 Cynoglossus semilaevis 75 1 33.4982 75 3.25916 14 19 25 51 33 59 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 988 gi|725572124|ref|XP_010338527.1| XP_010338527 PREDICTED: insulin-like growth factor I isoform X1 [Saimiri boliviensis boliviensis] 39432 Saimiri boliviensis boliviensis 208 1 35.4242 80 3.26076 15 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFNKPT + LCG+ LV+AL VCGERGF+ T 989 gi|1062847293|ref|XP_017935705.1| XP_017935705 PREDICTED: insulin-like growth factor I isoform X2 [Manacus vitellinus] 328815 Manacus vitellinus 130 1 34.2686 77 3.26353 14 19 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 990 gi|1096007040|ref|XP_018774277.1| XP_018774277 PREDICTED: insulin-like growth factor I isoform X2 [Serinus canaria] 9135 Serinus canaria 148 1 34.6538 78 3.26409 14 19 27 51 48 72 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 991 gi|56463259|gb|AAV91771.1| AAV91771 insulin-like growth factor, partial [Dicentrarchus labrax] 13489 Dicentrarchus labrax 79 1 33.4982 75 3.26452 14 19 25 51 18 44 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 992 gi|379975562|gb|AFD20696.1| AFD20696 insulin-like growth factor I transcript variant 6 [Cervus elaphus] 9860 Cervus elaphus 144 1 34.6538 78 3.28668 13 17 27 46 38 57 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 993 gi|829805565|ref|XP_012628134.1| XP_012628134 insulin-like growth factor I isoform X2 [Microcebus murinus] 30608 Microcebus murinus 137 1 34.6538 78 3.28696 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 994 gi|1326170421|ref|XP_023360188.1| XP_023360188 insulin-like growth factor I isoform X3 [Sarcophilus harrisii] 9305 Sarcophilus harrisii 176 1 35.039 79 3.29238 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 995 gi|699606649|ref|XP_009872029.1| XP_009872029 PREDICTED: insulin-like growth factor I, partial [Apaloderma vittatum] 57397 Apaloderma vittatum gi|677308539|gb|KFP90967.1| KFP90967 Insulin-like growth factor I, partial [Apaloderma vittatum] 57397 Apaloderma vittatum 134 1 34.6538 78 3.30406 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 996 gi|1191877814|ref|XP_020946797.1| XP_020946797 insulin-like growth factor I isoform X3 [Sus scrofa] 9823 Sus scrofa 164 1 35.039 79 3.30669 14 19 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 997 gi|60672480|gb|AAX33346.1| AAX33346 insulin, partial [Abrocoma bennettii] 108855 Abrocoma bennettii 50 1 33.4982 75 3.36441 13 20 22 46 1 25 25 0 FVNQHLCGSHLVEALYLVCGERGFF LVSRRLCGSNLVDALFLLCERNGFY V++ LCGS+LV+AL+L+C GF+ 998 gi|693583989|gb|AIS39010.1| AIS39010 insulin-like growth factor I, partial [Rana sylvatica] 45438 Rana sylvatica 111 1 33.8834 76 3.3665 14 18 27 48 53 74 22 0 LCGSHLVEALYLVCGERGFFXT LCGAELVDALQFVCGDRGFFFS LCG+ LV+AL VCG+RGFF + 999 gi|68164332|gb|AAY87163.1| AAY87163 insulin-like growth factor 1, partial [Cervus nippon] 9863 Cervus nippon gi|149213313|gb|ABR22797.1| ABR22797 insulin-like growth factor 1, partial [Bos frontalis] 30520 Bos frontalis 53 1 33.4982 75 3.36821 13 18 25 46 31 52 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1000 gi|1297583450|ref|XP_023044679.1| XP_023044679 insulin-like growth factor I isoform X3 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles 185 1 35.039 79 3.37238 14 19 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1001 gi|678141344|gb|KFV10516.1| KFV10516 Insulin-like growth factor I, partial [Tauraco erythrolophus] 121530 Tauraco erythrolophus 134 1 34.6538 78 3.37416 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1002 gi|685574625|ref|XP_009179809.1| XP_009179809 insulin-like growth factor I isoform X3 [Papio anubis] 9555 Papio anubis gi|966974094|ref|XP_015008020.1| XP_015008020 PREDICTED: insulin-like growth factor I isoform X2 [Macaca mulatta] 9544 Macaca mulatta gi|982283325|ref|XP_015286941.1| XP_015286941 PREDICTED: insulin-like growth factor I isoform X3 [Macaca fascicularis] 9541 Macaca fascicularis gi|1381457827|ref|XP_011760041.2| XP_011760041 insulin-like growth factor I isoform X3 [Macaca nemestrina] 9545 Macaca nemestrina 143 1 34.6538 78 3.37753 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1003 gi|675682704|ref|XP_009002741.1| XP_009002741 PREDICTED: insulin-like growth factor I isoform X1 [Callithrix jacchus] 9483 Callithrix jacchus 176 1 35.039 79 3.39182 15 19 25 51 74 100 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFNKPT + LCG+ LV+AL VCGERGF+ T 1004 gi|694659902|ref|XP_009485329.1| XP_009485329 PREDICTED: insulin-like growth factor I [Pelecanus crispus] 36300 Pelecanus crispus 145 1 34.6538 78 3.40325 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1005 gi|640807811|ref|XP_008060411.1| XP_008060411 insulin-like growth factor I isoform X1 [Carlito syrichta] 1868482 Carlito syrichta 209 1 35.4242 80 3.40395 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1006 gi|119618101|gb|EAW97695.1| EAW97695 insulin-like growth factor 1 (somatomedin C), isoform CRA_a [Homo sapiens] 9606 Homo sapiens 135 1 34.6538 78 3.42813 13 17 27 46 30 49 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1007 gi|846987777|ref|XP_012804090.1| XP_012804090 PREDICTED: insulin-like growth factor I [Jaculus jaculus] 51337 Jaculus jaculus 297 1 35.4242 80 3.43503 13 18 25 46 51 72 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1008 gi|209944020|gb|ACI96296.1| ACI96296 insulin growth factor-1 variant, partial [Bos taurus] 9913 Bos taurus 118 1 34.2686 77 3.43649 13 18 25 46 96 117 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1009 gi|918596910|ref|XP_013369757.1| XP_013369757 PREDICTED: insulin-like growth factor II isoform X1 [Chinchilla lanigera] 34839 Chinchilla lanigera gi|918596912|ref|XP_013369758.1| XP_013369758 PREDICTED: insulin-like growth factor II isoform X1 [Chinchilla lanigera] 34839 Chinchilla lanigera gi|918596914|ref|XP_013369759.1| XP_013369759 PREDICTED: insulin-like growth factor II isoform X1 [Chinchilla lanigera] 34839 Chinchilla lanigera 184 1 35.039 79 3.45079 13 18 24 49 29 54 26 0 NQHLCGSHLVEALYLVCGERGFFXTP SETLCGGELVDTLQFVCGDRGFYFRP ++ LCG LV+ L VCG+RGF+ P 1010 gi|675682717|ref|XP_009002743.1| XP_009002743 PREDICTED: insulin-like growth factor I isoform X4 [Callithrix jacchus] 9483 Callithrix jacchus 208 1 35.4242 80 3.45493 15 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFNKPT + LCG+ LV+AL VCGERGF+ T 1011 gi|1100903|gb|AAA96152.1| AAA96152 insulin-like growth factor-I, partial [Homo sapiens] 9606 Homo sapiens 139 1 34.6538 78 3.49717 13 17 27 46 34 53 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1012 gi|753220694|gb|AJI02567.1| AJI02567 insulin-like growth factor 1, partial [Capra hircus] 9925 Capra hircus 53 1 33.4982 75 3.50054 13 18 25 46 31 52 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1013 gi|829805571|ref|XP_012628135.1| XP_012628135 insulin-like growth factor I isoform X3 [Microcebus murinus] 30608 Microcebus murinus 130 1 34.2686 77 3.51309 13 17 27 46 30 49 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1014 gi|1034579378|ref|XP_016874750.1| XP_016874750 insulin-like growth factor I isoform X2 [Homo sapiens] 9606 Homo sapiens 179 1 35.039 79 3.53771 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1015 gi|48928114|gb|AAT47735.1| AAT47735 insulin-like growth factor 1, partial [Sus scrofa] 9823 Sus scrofa 134 1 34.2686 77 3.55598 13 17 27 46 28 47 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1016 gi|946808935|ref|XP_014388588.1| XP_014388588 PREDICTED: insulin [Myotis brandtii] 109478 Myotis brandtii 183 1 35.039 79 3.56563 13 15 2 21 164 183 20 0 IVEQCCTSICSLYQLENYCN IVDMCCNNFCSFYQLEYYCN IV+ CC + CS YQLE YCN 1017 gi|289541368|gb|ADD09807.1| ADD09807 insulin-like growth factor, partial [Branchiostoma belcheri] 7741 Branchiostoma belcheri 167 1 35.039 79 3.57878 11 16 1 21 58 78 21 0 GIVEQCCTSICSLYQLENYCN GLVEECCLNVCDYSHLESYCN G+VE+CC ++C LE+YCN 1018 gi|695144386|ref|XP_009499529.1| XP_009499529 PREDICTED: insulin-like growth factor I [Phalacrocorax carbo] 9209 Phalacrocorax carbo 153 1 34.6538 78 3.58871 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1019 gi|13936438|gb|AAK49814.1|AF246977_1 AAK49814 45 kDa IGFI-GFP fusion protein [synthetic construct] 32630 synthetic construct gi|14150457|gb|AAK54502.1|AF267909_1 AAK54502 45 kDa SIGFI-GFP fusion protein [synthetic construct] 32630 synthetic construct 410 1 35.8094 81 3.59697 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1020 gi|612051230|ref|XP_007503394.1| XP_007503394 PREDICTED: insulin-like growth factor I isoform X5 [Monodelphis domestica] 13616 Monodelphis domestica 176 1 35.039 79 3.59969 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 1021 gi|1331805692|gb|PNI65124.1| PNI65124 IGF1 isoform 5, partial [Pan troglodytes] 9598 Pan troglodytes 140 1 34.6538 78 3.62486 13 17 27 46 34 53 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1022 gi|704198307|ref|XP_010141310.1| XP_010141310 PREDICTED: insulin-like growth factor I [Buceros rhinoceros silvestris] 175836 Buceros rhinoceros silvestris 153 1 34.6538 78 3.62567 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1023 gi|701358709|ref|XP_009961122.1| XP_009961122 PREDICTED: insulin-like growth factor I [Tyto alba] 56313 Tyto alba 153 1 34.6538 78 3.62567 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1024 gi|1229748265|gb|AST35655.1| AST35655 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps 113 1 33.8834 76 3.66443 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1025 gi|1229748245|gb|AST35645.1| AST35645 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748247|gb|AST35646.1| AST35646 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748249|gb|AST35647.1| AST35647 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748251|gb|AST35648.1| AST35648 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748253|gb|AST35649.1| AST35649 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748255|gb|AST35650.1| AST35650 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748257|gb|AST35651.1| AST35651 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748259|gb|AST35652.1| AST35652 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748261|gb|AST35653.1| AST35653 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748263|gb|AST35654.1| AST35654 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748267|gb|AST35656.1| AST35656 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748269|gb|AST35657.1| AST35657 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748271|gb|AST35658.1| AST35658 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748273|gb|AST35659.1| AST35659 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748277|gb|AST35661.1| AST35661 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748279|gb|AST35662.1| AST35662 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748281|gb|AST35663.1| AST35663 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748283|gb|AST35664.1| AST35664 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748285|gb|AST35665.1| AST35665 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748287|gb|AST35666.1| AST35666 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748289|gb|AST35667.1| AST35667 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748291|gb|AST35668.1| AST35668 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748293|gb|AST35669.1| AST35669 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748295|gb|AST35670.1| AST35670 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1231288956|gb|ASU06083.1| ASU06083 insulin-like growth factor 1, partial [Ochotona collaris] 134600 Ochotona collaris gi|1231288958|gb|ASU06084.1| ASU06084 insulin-like growth factor 1, partial [Ochotona collaris] 134600 Ochotona collaris gi|1231288960|gb|ASU06085.1| ASU06085 insulin-like growth factor 1, partial [Ochotona collaris] 134600 Ochotona collaris gi|1231288962|gb|ASU06086.1| ASU06086 insulin-like growth factor 1, partial [Ochotona collaris] 134600 Ochotona collaris 113 1 33.8834 76 3.66443 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1026 gi|753220696|gb|AJI02568.1| AJI02568 insulin-like growth factor 1, partial [Capra hircus] 9925 Capra hircus 74 1 33.4982 75 3.67994 13 18 25 46 52 73 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1027 gi|734703910|ref|NP_001290078.1| NP_001290078 insulin-like growth factor I precursor [Meleagris gallopavo] 9103 Meleagris gallopavo gi|3309072|gb|AAC26006.1| AAC26006 insulin-like growth factor-I precursor [Meleagris gallopavo] 9103 Meleagris gallopavo 153 1 34.6538 78 3.70072 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1028 gi|1025403010|ref|XP_016408490.1| XP_016408490 PREDICTED: insulin-like growth factor II [Sinocyclocheilus rhinocerous] 307959 Sinocyclocheilus rhinocerous 212 1 35.039 79 3.72398 15 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDALQFVCGERGFYFSRPT + LCG LV+AL VCGERGF+ + T 1029 gi|701292128|ref|XP_010021936.1| XP_010021936 PREDICTED: LOW QUALITY PROTEIN: insulin-like growth factor I, partial [Nestor notabilis] 176057 Nestor notabilis 137 1 34.2686 77 3.72686 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1030 gi|1135106845|ref|YP_009342247.1| YP_009342247 putative insuline-like growth factor family member [Lymphocystis disease virus Sa] 1898060 Lymphocystis disease virus Sa gi|1052158266|gb|AOC55263.1| AOC55263 putative insuline-like growth factor family member [Lymphocystis disease virus Sa] 1898060 Lymphocystis disease virus Sa 80 1 33.4982 75 3.73029 16 17 25 49 21 45 25 0 QHLCGSHLVEALYLVCGERGFFXTP QTLCGSELVDALELVCGEYGGIYRP Q LCGS LV+AL LVCGE G P 1031 gi|944296912|gb|KQL60191.1| KQL60191 insulin-like growth factor I [Amazona aestiva] 12930 Amazona aestiva 153 1 34.6538 78 3.73882 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1032 gi|562823295|ref|XP_006141463.1| XP_006141463 PREDICTED: insulin-like growth factor I isoform X2 [Tupaia chinensis] 246437 Tupaia chinensis 153 1 34.6538 78 3.73882 14 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFSKPT + LCG+ LV+AL VCG+RGF+ + T 1033 gi|821098328|ref|XP_012376977.1| XP_012376977 insulin-like growth factor I isoform X3 [Dasypus novemcinctus] 9361 Dasypus novemcinctus 143 1 34.6538 78 3.74746 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1034 gi|694951895|ref|XP_009424389.1| XP_009424389 insulin-like growth factor I isoform X3 [Pan troglodytes] 9598 Pan troglodytes gi|1099127612|ref|XP_018894893.1| XP_018894893 PREDICTED: insulin-like growth factor I isoform X2 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla 180 1 35.039 79 3.78007 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1035 gi|126722801|ref|NP_001075495.1| NP_001075495 insulin-like growth factor I precursor [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus gi|12644472|sp|Q95222.3|IGF1_RABIT Q95222 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 9986 Oryctolagus cuniculus gi|2522202|gb|AAB80950.1| AAB80950 insulin-like growth factor IB [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 143 1 34.6538 78 3.78659 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1036 gi|780260|emb|CAA27250.1| CAA27250 pot. IGF-I precursor, partial [Homo sapiens] 9606 Homo sapiens 54 1 33.4982 75 3.79417 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1037 gi|1229748297|gb|AST35671.1| AST35671 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748299|gb|AST35672.1| AST35672 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps gi|1229748301|gb|AST35673.1| AST35673 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps 52 1 33.4982 75 3.80411 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1038 gi|548466855|ref|XP_005680596.1| XP_005680596 PREDICTED: insulin-like growth factor I isoform X8 [Capra hircus] 9925 Capra hircus 137 1 34.2686 77 3.80566 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1039 gi|96997211|gb|ABF57993.1| ABF57993 insulin-like growth factor-1, partial [Anser anser] 8843 Anser anser 135 1 34.2686 77 3.80711 14 19 27 51 40 64 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1040 gi|543260555|ref|XP_005421104.1| XP_005421104 PREDICTED: insulin-like growth factor I [Geospiza fortis] 48883 Geospiza fortis 153 1 34.6538 78 3.8162 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1041 gi|58176804|pdb|1TGR|A 1TGR_A Chain A, Crystal Structure Of Mini-igf-1(2) 9606 Homo sapiens gi|58176805|pdb|1TGR|B 1TGR_B Chain B, Crystal Structure Of Mini-igf-1(2) 9606 Homo sapiens 52 1 33.4982 75 3.84093 13 18 25 46 3 24 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1042 gi|1209970007|ref|XP_021392027.1| XP_021392027 insulin-like growth factor I [Lonchura striata domestica] 299123 Lonchura striata domestica gi|1208031891|gb|OWK58295.1| OWK58295 Insulin-like growth factor I [Lonchura striata domestica] 299123 Lonchura striata domestica 153 1 34.6538 78 3.85547 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1043 gi|1331935279|gb|PNJ83166.1| PNJ83166 IGF1 isoform 5, partial [Pongo abelii] 9601 Pongo abelii 140 1 34.2686 77 3.8589 13 17 27 46 34 53 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1044 gi|923093989|gb|ALB07777.1| ALB07777 insulin-like growth factor I [Cairina moschata] 8855 Cairina moschata 153 1 34.6538 78 3.89515 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1045 gi|677990888|ref|XP_009075236.1| XP_009075236 PREDICTED: insulin-like growth factor I [Acanthisitta chloris] 57068 Acanthisitta chloris gi|677299968|gb|KFP82396.1| KFP82396 Insulin-like growth factor I [Acanthisitta chloris] 57068 Acanthisitta chloris 153 1 34.6538 78 3.89515 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1046 gi|527264547|ref|XP_005150496.1| XP_005150496 PREDICTED: insulin-like growth factor I [Melopsittacus undulatus] 13146 Melopsittacus undulatus 153 1 34.6538 78 3.89515 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1047 gi|548466853|ref|XP_005680595.1| XP_005680595 PREDICTED: insulin-like growth factor I isoform X7 [Capra hircus] 9925 Capra hircus 138 1 34.2686 77 3.90475 13 18 25 46 36 57 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1048 gi|379975558|gb|AFD20694.1| AFD20694 insulin-like growth factor I transcript variant 4 [Cervus elaphus] 9860 Cervus elaphus 138 1 34.2686 77 3.90475 13 18 25 46 36 57 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1049 gi|1190375802|ref|XP_020838020.1| XP_020838020 insulin-like growth factor I isoform X6 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 185 1 35.039 79 3.90675 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 1050 gi|1040216616|ref|XP_017197106.1| XP_017197106 PREDICTED: insulin-like growth factor I isoform X6 [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 136 1 34.2686 77 3.90764 13 17 27 46 30 49 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1051 gi|1111013222|ref|XP_009286654.2| XP_009286654 PREDICTED: insulin-like growth factor I [Aptenodytes forsteri] 9233 Aptenodytes forsteri 161 1 34.6538 78 3.92583 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1052 gi|556779600|ref|XP_005984849.1| XP_005984849 PREDICTED: insulin-like growth factor I isoform X8 [Pantholops hodgsonii] 59538 Pantholops hodgsonii 137 1 34.2686 77 3.92699 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1053 gi|528949352|ref|XP_005206557.1| XP_005206557 insulin-like growth factor I isoform X8 [Bos taurus] 9913 Bos taurus gi|555973359|ref|XP_005898676.1| XP_005898676 PREDICTED: insulin-like growth factor I isoform X8 [Bos mutus] 72004 Bos mutus gi|594069967|ref|XP_006058876.1| XP_006058876 PREDICTED: insulin-like growth factor I isoform X8 [Bubalus bubalis] 89462 Bubalus bubalis gi|742176932|ref|XP_010851733.1| XP_010851733 PREDICTED: insulin-like growth factor I isoform X8 [Bison bison bison] 43346 Bison bison bison gi|1131277604|ref|XP_019816753.1| XP_019816753 PREDICTED: insulin-like growth factor I isoform X11 [Bos indicus] 9915 Bos indicus 137 1 34.2686 77 3.92699 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1054 gi|7677623|gb|AAF67202.1|AF260131_1 AAF67202 IGF-I [Coturnix japonica] 93934 Coturnix japonica 153 1 34.6538 78 3.93523 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1055 gi|701330323|ref|XP_009977601.1| XP_009977601 PREDICTED: insulin-like growth factor I [Tauraco erythrolophus] 121530 Tauraco erythrolophus 153 1 34.6538 78 3.93523 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1056 gi|698472308|ref|XP_009706473.1| XP_009706473 PREDICTED: insulin-like growth factor I [Cariama cristata] 54380 Cariama cristata gi|677277637|gb|KFP68955.1| KFP68955 Insulin-like growth factor I [Cariama cristata] 54380 Cariama cristata 153 1 34.6538 78 3.93523 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1057 gi|675424971|ref|XP_008926216.1| XP_008926216 PREDICTED: insulin-like growth factor I isoform X1 [Manacus vitellinus] 328815 Manacus vitellinus gi|1051155470|ref|XP_017660390.1| XP_017660390 PREDICTED: insulin-like growth factor I [Lepidothrix coronata] 321398 Lepidothrix coronata 153 1 34.6538 78 3.93523 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1058 gi|1231288964|gb|ASU06087.1| ASU06087 insulin-like growth factor 1, partial [Ochotona collaris] 134600 Ochotona collaris 107 1 33.8834 76 3.93754 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1059 gi|1187578240|ref|XP_020736523.1| XP_020736523 insulin-like growth factor I isoform X4 [Odocoileus virginianus texanus] 9880 Odocoileus virginianus texanus 137 1 34.2686 77 3.96828 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1060 gi|52138671|ref|NP_001004384.1| NP_001004384 insulin-like growth factor I preproprotein [Gallus gallus] 9031 Gallus gallus gi|529431682|ref|XP_005235639.1| XP_005235639 PREDICTED: insulin-like growth factor I [Falco peregrinus] 8954 Falco peregrinus gi|541958717|ref|XP_005435105.1| XP_005435105 PREDICTED: insulin-like growth factor I [Falco cherrug] 345164 Falco cherrug gi|543718185|ref|XP_005500337.1| XP_005500337 insulin-like growth factor I [Columba livia] 8932 Columba livia gi|663239997|ref|XP_008503575.1| XP_008503575 PREDICTED: insulin-like growth factor I [Calypte anna] 9244 Calypte anna gi|675630565|ref|XP_008943830.1| XP_008943830 PREDICTED: insulin-like growth factor I [Merops nubicus] 57421 Merops nubicus gi|690464958|ref|XP_009331227.1| XP_009331227 PREDICTED: insulin-like growth factor I [Pygoscelis adeliae] 9238 Pygoscelis adeliae gi|694846209|ref|XP_009464121.1| XP_009464121 PREDICTED: insulin-like growth factor I [Nipponia nippon] 128390 Nipponia nippon gi|696979821|ref|XP_009558804.1| XP_009558804 PREDICTED: insulin-like growth factor I [Cuculus canorus] 55661 Cuculus canorus gi|697013357|ref|XP_009578464.1| XP_009578464 PREDICTED: insulin-like growth factor I [Fulmarus glacialis] 30455 Fulmarus glacialis gi|697497471|ref|XP_009678279.1| XP_009678279 PREDICTED: insulin-like growth factor I isoform X2 [Struthio camelus australis] 441894 Struthio camelus australis gi|697822326|ref|XP_009647544.1| XP_009647544 PREDICTED: insulin-like growth factor I [Egretta garzetta] 188379 Egretta garzetta gi|699643134|ref|XP_009894686.1| XP_009894686 PREDICTED: insulin-like growth factor I [Picoides pubescens] 118200 Picoides pubescens gi|699675757|ref|XP_009885716.1| XP_009885716 PREDICTED: insulin-like growth factor I [Charadrius vociferus] 50402 Charadrius vociferus gi|700330663|ref|XP_009912214.1| XP_009912214 PREDICTED: insulin-like growth factor I [Haliaeetus albicilla] 8969 Haliaeetus albicilla gi|700376308|ref|XP_009942603.1| XP_009942603 PREDICTED: insulin-like growth factor I [Opisthocomus hoazin] 30419 Opisthocomus hoazin gi|700435576|ref|XP_009956793.1| XP_009956793 PREDICTED: insulin-like growth factor I [Leptosomus discolor] 188344 Leptosomus discolor gi|701431503|ref|XP_010004103.1| XP_010004103 PREDICTED: insulin-like growth factor I [Chaetura pelagica] 8897 Chaetura pelagica gi|704323459|ref|XP_010169838.1| XP_010169838 PREDICTED: insulin-like growth factor I [Antrostomus carolinensis] 279965 Caprimulgus carolinensis gi|704485312|ref|XP_010074341.1| XP_010074341 PREDICTED: insulin-like growth factor I [Pterocles gutturalis] 240206 Pterocles gutturalis gi|705673534|ref|XP_010115972.1| XP_010115972 PREDICTED: insulin-like growth factor I [Chlamydotis macqueenii] 187382 Chlamydotis undulata macqueenii gi|719797424|ref|XP_010224959.1| XP_010224959 PREDICTED: insulin-like growth factor I [Tinamus guttatus] 94827 Tinamus guttatus gi|723137451|ref|XP_010285461.1| XP_010285461 PREDICTED: insulin-like growth factor I [Phaethon lepturus] 97097 Phaethon lepturus gi|729737024|ref|XP_010564607.1| XP_010564607 PREDICTED: insulin-like growth factor I [Haliaeetus leucocephalus] 52644 Haliaeetus leucocephalus gi|768356180|ref|XP_011575108.1| XP_011575108 PREDICTED: insulin-like growth factor I [Aquila chrysaetos canadensis] 216574 Aquila chrysaetos canadensis gi|926507572|ref|XP_013802707.1| XP_013802707 PREDICTED: insulin-like growth factor I [Apteryx australis mantelli] 202946 Apteryx australis mantelli gi|960956793|ref|XP_014792990.1| XP_014792990 PREDICTED: insulin-like growth factor I [Calidris pugnax] 198806 Philomachus pugnax gi|1003716101|ref|XP_015723060.1| XP_015723060 PREDICTED: insulin-like growth factor I [Coturnix japonica] 93934 Coturnix japonica gi|1201820447|ref|XP_021243075.1| XP_021243075 insulin-like growth factor I isoform X1 [Numida meleagris] 8996 Numida meleagris gi|124249|sp|P18254.1|IGF1_CHICK P18254 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 9031 Gallus gallus gi|211951|gb|AAA48828.1| AAA48828 insulin-like growth factor precursor [Gallus gallus] 9031 Gallus gallus gi|7416840|dbj|BAA94079.1| BAA94079 IGF-I [Struthio camelus] 8801 Struthio camelus gi|239586398|gb|ACR83546.1| ACR83546 insulin-like growth factor [Gallus gallus] 9031 Gallus gallus gi|456496652|gb|AGG38004.1| AGG38004 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus gi|678139871|gb|KFV09043.1| KFV09043 Insulin-like growth factor I [Pterocles gutturalis] 240206 Pterocles gutturalis gi|1159652271|gb|OPJ80529.1| OPJ80529 insulin-like growth factor I [Patagioenas fasciata monilis] 372326 Patagioenas fasciata monilis gi|1307746745|gb|PKK30051.1| PKK30051 insulin-like growth factor 1 (somatomedin C), transcript variant X1 [Columba livia] 8932 Columba livia gi|1315510027|gb|PKU44654.1| PKU44654 insulin-like growth factor i [Limosa lapponica baueri] 1758121 Limosa lapponica baueri 153 1 34.6538 78 3.97572 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1061 gi|524984255|ref|XP_005040114.1| XP_005040114 PREDICTED: insulin-like growth factor I [Ficedula albicollis] 59894 Ficedula albicollis 153 1 34.6538 78 3.97572 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1062 gi|165931|gb|AAA80533.1| AAA80533 insulin-like growth factor I [Ovis aries] 9940 Ovis aries gi|165934|gb|AAA80535.1| AAA80535 insulin-like growth factor I [Ovis aries] 9940 Ovis aries gi|165936|gb|AAA31545.1| AAA31545 insulin-like growth factor I precursor [Ovis aries] 9940 Ovis aries gi|165939|gb|AAA31547.1| AAA31547 insulin-like growth factor I precursor A' [Ovis aries] 9940 Ovis aries gi|833788|emb|CAA49232.1| CAA49232 insulin like growth factor-I [Ovis aries] 9940 Ovis aries 130 1 34.2686 77 3.98602 14 19 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1063 gi|109037|pir||S22878 S22878 insulin-like growth factor I precursor, splice form 2 - sheep 9940 Ovis aries gi|1839018|emb|CAA35098.1| CAA35098 insuline-like growth factor-I (2) [Ovis aries] 9940 Ovis aries 138 1 34.2686 77 3.98721 13 18 25 46 36 57 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1064 gi|514758686|ref|XP_005022610.1| XP_005022610 insulin-like growth factor I [Anas platyrhynchos] 8839 Anas platyrhynchos gi|902894346|ref|XP_013036515.1| XP_013036515 PREDICTED: insulin-like growth factor I [Anser cygnoides domesticus] 381198 Anser cygnoides domesticus gi|15823771|dbj|BAB69036.1| BAB69036 Insulin-like growth factor-I [Anas platyrhynchos] 8839 Anas platyrhynchos gi|108863051|gb|ABG22117.1| ABG22117 insulin-like growth factor I [Anser anser] 8843 Anser anser gi|659104365|gb|AID60635.1| AID60635 IGF-I [Cairina moschata] 8855 Cairina moschata 153 1 34.6538 78 4.01662 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1065 gi|224095455|ref|XP_002199849.1| XP_002199849 PREDICTED: insulin-like growth factor I [Taeniopygia guttata] 59729 Taeniopygia guttata gi|542147567|ref|XP_005482778.1| XP_005482778 PREDICTED: insulin-like growth factor I [Zonotrichia albicollis] 44394 Zonotrichia albicollis gi|543369418|ref|XP_005527936.1| XP_005527936 PREDICTED: insulin-like growth factor I [Pseudopodoces humilis] 181119 Pseudopodoces humilis gi|669283902|ref|XP_008634589.1| XP_008634589 PREDICTED: insulin-like growth factor I [Corvus brachyrhynchos] 85066 Corvus brachyrhynchos gi|683923684|ref|XP_009092444.1| XP_009092444 PREDICTED: insulin-like growth factor I isoform X1 [Serinus canaria] 9135 Serinus canaria gi|727060080|ref|XP_010408753.1| XP_010408753 insulin-like growth factor I [Corvus cornix cornix] 932674 Corvus cornix cornix gi|959058884|ref|XP_014732446.1| XP_014732446 PREDICTED: insulin-like growth factor I [Sturnus vulgaris] 9172 Sturnus vulgaris gi|998691984|ref|XP_015483546.1| XP_015483546 PREDICTED: insulin-like growth factor I [Parus major] 9157 Parus major gi|1340982469|ref|XP_023792657.1| XP_023792657 insulin-like growth factor I [Cyanistes caeruleus] 156563 Cyanistes caeruleus 153 1 34.6538 78 4.01662 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1066 gi|1187578238|ref|XP_020736521.1| XP_020736521 insulin-like growth factor I isoform X3 [Odocoileus virginianus texanus] 9880 Odocoileus virginianus texanus 138 1 34.2686 77 4.02908 13 18 25 46 36 57 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1067 gi|556779598|ref|XP_005984848.1| XP_005984848 PREDICTED: insulin-like growth factor I isoform X7 [Pantholops hodgsonii] 59538 Pantholops hodgsonii gi|513856641|gb|AGO28165.1| AGO28165 IGF-I splicing variant class 2 [Capra hircus] 9925 Capra hircus 138 1 34.2686 77 4.02908 13 18 25 46 36 57 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1068 gi|528949350|ref|XP_005206556.1| XP_005206556 insulin-like growth factor I isoform X7 [Bos taurus] 9913 Bos taurus gi|555973357|ref|XP_005898675.1| XP_005898675 PREDICTED: insulin-like growth factor I isoform X7 [Bos mutus] 72004 Bos mutus gi|742176928|ref|XP_010851732.1| XP_010851732 PREDICTED: insulin-like growth factor I isoform X7 [Bison bison bison] 43346 Bison bison bison gi|1131277600|ref|XP_019816752.1| XP_019816752 PREDICTED: insulin-like growth factor I isoform X10 [Bos indicus] 9915 Bos indicus gi|326703751|gb|AEA06509.1| AEA06509 insulin-like growth factor I variant 3 [Bos taurus] 9913 Bos taurus 138 1 34.2686 77 4.02908 13 18 25 46 36 57 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1069 gi|803030722|ref|XP_012015049.1| XP_012015049 PREDICTED: insulin-like growth factor I isoform X3 [Ovis aries] 9940 Ovis aries 137 1 34.2686 77 4.05216 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1070 gi|667309749|ref|XP_008584172.1| XP_008584172 PREDICTED: insulin-like growth factor I isoform X4 [Galeopterus variegatus] 482537 Galeopterus variegatus 137 1 34.2686 77 4.05216 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1071 gi|154354395|gb|ABS76279.1| ABS76279 insulin-like growth factor 1 [Anas platyrhynchos] 8839 Anas platyrhynchos 153 1 34.6538 78 4.05794 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1072 gi|723561002|ref|XP_010301820.1| XP_010301820 PREDICTED: insulin-like growth factor I [Balearica regulorum gibbericeps] 100784 Balearica pavonina gibbericeps 153 1 34.6538 78 4.05794 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1073 gi|938067001|gb|KPP66907.1| KPP66907 insulin-like growth factor II-like, partial [Scleropages formosus] 113540 Scleropages formosus 185 1 35.039 79 4.06287 19 24 8 51 14 54 44 3 TSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT TMALSLYLVEAVST---ETLCGGELVDALQFVCGYRGFYFSRPT T SLY +E + LCG LV+AL VCG RGF+ + T 1074 gi|1160133448|ref|XP_020369305.1| XP_020369305 insulin-like growth factor I [Rhincodon typus] 259920 Rhincodon typus 151 1 34.6538 78 4.08392 15 20 21 51 48 78 31 0 NFVNQHLCGSHLVEALYLVCGERGFFXTPXT NASPETLCGAELVDALQFVCGDRGFYFNKPT N + LCG+ LV+AL VCG+RGF+ T 1075 gi|513856637|gb|AGO28163.1| AGO28163 IGF-I splicing variant class 1w [Capra hircus] 9925 Capra hircus 130 1 34.2686 77 4.11386 13 18 25 46 28 49 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1076 gi|1190375794|ref|XP_020838016.1| XP_020838016 insulin-like growth factor I isoform X2 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 221 1 35.039 79 4.12851 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 1077 gi|655741695|ref|XP_008254942.1| XP_008254942 PREDICTED: insulin-like growth factor I isoform X5 [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus gi|1850346|gb|AAB48032.1| AAB48032 insulin-like growth factor 1 precursor [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 137 1 34.2686 77 4.1378 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1078 gi|803030717|ref|XP_012015041.1| XP_012015041 PREDICTED: insulin-like growth factor I isoform X2 [Ovis aries] 9940 Ovis aries gi|165933|gb|AAA80534.1| AAA80534 insulin-like growth factor I [Ovis aries] 9940 Ovis aries gi|833787|emb|CAA49231.1| CAA49231 insulin like growth factor-I [Ovis aries] 9940 Ovis aries 138 1 34.2686 77 4.15734 13 18 25 46 36 57 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1079 gi|1815685|gb|AAB47485.1| AAB47485 prepro IGF-Ia [Equus caballus] 9796 Equus caballus 127 1 34.2686 77 4.17089 14 19 25 51 25 51 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1080 gi|507929111|ref|XP_004675803.1| XP_004675803 PREDICTED: insulin-like growth factor I isoform X1 [Condylura cristata] 143302 Condylura cristata 197 1 35.039 79 4.17738 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1081 gi|1334010079|ref|XP_023572689.1| XP_023572689 insulin-like growth factor I isoform X3 [Octodon degus] 10160 Octodon degus gi|1334010081|ref|XP_023572691.1| XP_023572691 insulin-like growth factor I isoform X3 [Octodon degus] 10160 Octodon degus gi|1334010083|ref|XP_023572696.1| XP_023572696 insulin-like growth factor I isoform X3 [Octodon degus] 10160 Octodon degus 130 1 34.2686 77 4.20135 14 19 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1082 gi|74315222|gb|ABA02291.1| ABA02291 IGF-1, partial [Anas platyrhynchos] 8839 Anas platyrhynchos 160 1 34.6538 78 4.21296 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1083 gi|1016717651|ref|XP_016078700.1| XP_016078700 PREDICTED: insulin-like growth factor I isoform X3 [Miniopterus natalensis] 291302 Miniopterus natalensis gi|1016717653|ref|XP_016078701.1| XP_016078701 PREDICTED: insulin-like growth factor I isoform X3 [Miniopterus natalensis] 291302 Miniopterus natalensis 127 1 34.2686 77 4.21508 14 19 25 51 25 51 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1084 gi|1121804748|ref|XP_019507445.1| XP_019507445 PREDICTED: insulin-like growth factor I isoform X2 [Hipposideros armiger] 186990 Hipposideros armiger 171 1 34.6538 78 4.22018 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1085 gi|585158149|ref|XP_006731371.1| XP_006731371 PREDICTED: insulin-like growth factor I isoform X2 [Leptonychotes weddellii] 9713 Leptonychotes weddellii gi|1212186061|ref|XP_021543251.1| XP_021543251 insulin-like growth factor I isoform X3 [Neomonachus schauinslandi] 29088 Monachus schauinslandi 137 1 34.2686 77 4.22524 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1086 gi|466007419|ref|XP_004269503.1| XP_004269503 PREDICTED: insulin-like growth factor I isoform X5 [Orcinus orca] 9733 Orcinus orca gi|470635295|ref|XP_004323176.1| XP_004323176 PREDICTED: insulin-like growth factor I isoform X2 [Tursiops truncatus] 9739 Tursiops truncatus gi|1246218093|ref|XP_022455545.1| XP_022455545 insulin-like growth factor I isoform X5 [Delphinapterus leucas] 9749 Delphinapterus leucas gi|1378908141|ref|XP_024587966.1| XP_024587966 insulin-like growth factor I isoform X7 [Neophocaena asiaeorientalis asiaeorientalis] 1706337 Neophocaena asiaeorientalis asiaeorientalis 137 1 34.2686 77 4.22524 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1087 gi|1384951844|ref|XP_024787015.1| XP_024787015 insulin-like growth factor I isoform X2 [Pan paniscus] 9597 Pan paniscus 173 1 34.6538 78 4.24635 14 19 25 51 28 54 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1088 gi|170780297|gb|ACB37316.1| ACB37316 insulin-like growth factor I, partial [Paralichthys orbignyanus] 336824 Paralichthys orbignyanus 120 1 33.8834 76 4.25236 14 19 25 51 22 48 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1089 gi|29293015|gb|AAO73854.1|AF402669_1 AAO73854 insulin-like growth factor I precursor, partial [Morone chrysops x Morone saxatilis] 45352 Morone chrysops x Morone saxatilis gi|29293017|gb|AAO73855.1|AF402670_1 AAO73855 insulin-like growth factor I precursor, partial [Morone saxatilis] 34816 Morone saxatilis gi|29293019|gb|AAO73856.1|AF402671_1 AAO73856 insulin-like growth factor I precursor, partial [Morone chrysops] 46259 Morone chrysops gi|29293021|gb|AAO73857.1|AF402672_1 AAO73857 insulin-like growth factor I precursor, partial [Morone americana] 46260 Morone americana 108 1 33.8834 76 4.25809 14 19 25 51 23 49 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1090 gi|1020505446|ref|XP_016091664.1| XP_016091664 PREDICTED: insulin-like growth factor II [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 212 1 35.039 79 4.26027 15 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDALQFVCGERGFYFSRPT + LCG LV+AL VCGERGF+ + T 1091 gi|8100793|gb|AAF72409.1| AAF72409 insulin-like growth factor I, partial [Bos taurus] 9913 Bos taurus 133 1 34.2686 77 4.31743 14 18 27 51 33 57 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1092 gi|48928116|gb|AAT47736.1| AAT47736 insulin-like growth factor 1, partial [Sus scrofa] 9823 Sus scrofa 56 1 33.113 74 4.32949 13 18 25 46 26 47 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1093 gi|1334644065|ref|XP_023584744.1| XP_023584744 insulin-like growth factor I isoform X5 [Trichechus manatus latirostris] 127582 Trichechus manatus latirostris 130 1 34.2686 77 4.33608 14 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1094 gi|674049317|ref|XP_008830830.1| XP_008830830 PREDICTED: insulin-like growth factor I isoform X4 [Nannospalax galili] 1026970 Nannospalax galili 137 1 34.2686 77 4.35985 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1095 gi|466007424|ref|XP_004269504.1| XP_004269504 PREDICTED: insulin-like growth factor I isoform X6 [Orcinus orca] 9733 Orcinus orca gi|602684154|ref|XP_007454331.1| XP_007454331 PREDICTED: insulin-like growth factor I isoform X4 [Lipotes vexillifer] 118797 Lipotes vexillifer gi|1378908143|ref|XP_024587967.1| XP_024587967 insulin-like growth factor I isoform X8 [Neophocaena asiaeorientalis asiaeorientalis] 1706337 Neophocaena asiaeorientalis asiaeorientalis 130 1 34.2686 77 4.38194 14 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1096 gi|516317428|gb|AGO86049.1| AGO86049 insulin-like growth factor 1, partial [Leiostomus xanthurus] 59837 Leiostomus xanthurus 112 1 33.8834 76 4.40122 14 19 25 51 45 71 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1097 gi|632973204|ref|XP_007903038.1| XP_007903038 PREDICTED: insulin-like growth factor II [Callorhinchus milii] 7868 Callorhinchus milii 318 1 35.4242 80 4.40234 14 18 25 51 160 186 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDTLQFVCGERGFYFSRAT + LCG LV+ L VCGERGF+ + T 1098 gi|594622381|ref|XP_007165846.1| XP_007165846 PREDICTED: insulin-like growth factor I isoform X5 [Balaenoptera acutorostrata scammoni] 310752 Balaenoptera acutorostrata scammoni 137 1 34.2686 77 4.40567 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1099 gi|297692761|ref|XP_002823704.1| XP_002823704 insulin-like growth factor I isoform X4 [Pongo abelii] 9601 Pongo abelii gi|795095469|ref|XP_011790443.1| XP_011790443 PREDICTED: insulin-like growth factor I isoform X5 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus gi|1297583463|ref|XP_023044835.1| XP_023044835 insulin-like growth factor I isoform X5 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles gi|1331935280|gb|PNJ83167.1| PNJ83167 IGF1 isoform 6 [Pongo abelii] 9601 Pongo abelii 137 1 34.2686 77 4.40567 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1100 gi|7438593|pir||S15778 S15778 insulin chain B - bovine (fragments) 30522 Bos indicus x Bos taurus 17 1 33.113 74 4.41175 14 14 35 49 1 15 15 0 ALYLVCGERGFFXTP ALYLVCGERGFFYTP ALYLVCGERGFF TP 1101 gi|884932630|ref|XP_013014489.1| XP_013014489 insulin-like growth factor I isoform X2 [Cavia porcellus] 10141 Cavia porcellus gi|884932632|ref|XP_013014490.1| XP_013014490 insulin-like growth factor I isoform X2 [Cavia porcellus] 10141 Cavia porcellus gi|884932634|ref|XP_013014491.1| XP_013014491 insulin-like growth factor I isoform X2 [Cavia porcellus] 10141 Cavia porcellus gi|884932636|ref|XP_013014492.1| XP_013014492 insulin-like growth factor I isoform X2 [Cavia porcellus] 10141 Cavia porcellus gi|124248|sp|P17647.1|IGF1_CAVPO P17647 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 10141 Cavia porcellus gi|49548|emb|CAA37127.1| CAA37127 unnamed protein product [Cavia porcellus] 10141 Cavia porcellus 130 1 34.2686 77 4.42828 14 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1102 gi|1391555111|ref|XP_025027023.1| XP_025027023 insulin-like growth factor I isoform X3 [Python bivittatus] 176946 Python bivittatus 132 1 34.2686 77 4.43147 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1103 gi|33341971|emb|CAE18111.1| CAE18111 insulin-like growth factor 1, partial [Dicentrarchus labrax] 13489 Dicentrarchus labrax 104 1 33.4982 75 4.44456 14 19 25 51 23 49 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1104 gi|357061810|gb|AET50989.1| AET50989 insulin-like growth factor 1 [Gallus gallus] 9031 Gallus gallus gi|374082374|gb|AEY81357.1| AEY81357 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus gi|374082378|gb|AEY81359.1| AEY81359 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus gi|374082386|gb|AEY81363.1| AEY81363 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus 153 1 34.2686 77 4.44922 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1105 gi|1334010077|ref|XP_023572687.1| XP_023572687 insulin-like growth factor I isoform X2 [Octodon degus] 10160 Octodon degus 137 1 34.2686 77 4.45196 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1106 gi|163659901|ref|NP_001104754.1| NP_001104754 insulin-like growth factor I isoform 2 precursor [Homo sapiens] 9606 Homo sapiens gi|114646565|ref|XP_001156403.1| XP_001156403 insulin-like growth factor I isoform X8 [Pan troglodytes] 9598 Pan troglodytes gi|332241626|ref|XP_003269979.1| XP_003269979 PREDICTED: insulin-like growth factor I isoform X4 [Nomascus leucogenys] 61853 Nomascus leucogenys gi|402887437|ref|XP_003907100.1| XP_003907100 insulin-like growth factor I isoform X4 [Papio anubis] 9555 Papio anubis gi|426373900|ref|XP_004053824.1| XP_004053824 PREDICTED: insulin-like growth factor I isoform X5 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla gi|544472489|ref|XP_005572098.1| XP_005572098 PREDICTED: insulin-like growth factor I isoform X4 [Macaca fascicularis] 9541 Macaca fascicularis gi|635067661|ref|XP_008002634.1| XP_008002634 PREDICTED: insulin-like growth factor I isoform X4 [Chlorocebus sabaeus] 60711 Chlorocebus sabaeus gi|675800439|ref|XP_008956267.1| XP_008956267 insulin-like growth factor I isoform X5 [Pan paniscus] 9597 Pan paniscus gi|724963739|ref|XP_010355575.1| XP_010355575 PREDICTED: insulin-like growth factor I isoform X5 [Rhinopithecus roxellana] 61622 Rhinopithecus roxellana gi|795311396|ref|XP_011824034.1| XP_011824034 PREDICTED: insulin-like growth factor I isoform X5 [Mandrillus leucophaeus] 9568 Mandrillus leucophaeus gi|795427551|ref|XP_011760044.1| XP_011760044 insulin-like growth factor I isoform X4 [Macaca nemestrina] 9545 Macaca nemestrina gi|795456344|ref|XP_011888072.1| XP_011888072 PREDICTED: insulin-like growth factor I isoform X5 [Cercocebus atys] 9531 Cercocebus atys gi|966974096|ref|XP_015008021.1| XP_015008021 PREDICTED: insulin-like growth factor I isoform X3 [Macaca mulatta] 9544 Macaca mulatta gi|1059185479|ref|XP_017748950.1| XP_017748950 PREDICTED: insulin-like growth factor I isoform X5 [Rhinopithecus bieti] 61621 Rhinopithecus bieti gi|184834|gb|AAA52789.1| AAA52789 insulin-like growth factor I [Homo sapiens] 9606 Homo sapiens gi|60819413|gb|AAX36499.1| AAX36499 insulin-like growth factor 1 [synthetic construct] 32630 synthetic construct gi|119618103|gb|EAW97697.1| EAW97697 insulin-like growth factor 1 (somatomedin C), isoform CRA_c [Homo sapiens] 9606 Homo sapiens gi|1331805693|gb|PNI65125.1| PNI65125 IGF1 isoform 6 [Pan troglodytes] 9598 Pan troglodytes 137 1 34.2686 77 4.45196 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1107 gi|641707925|ref|XP_008142971.1| XP_008142971 PREDICTED: insulin-like growth factor I isoform X3 [Eptesicus fuscus] 29078 Eptesicus fuscus 137 1 34.2686 77 4.45196 14 18 27 51 37 61 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1108 gi|213439|gb|AAB59947.1| AAB59947 insulin-like growth factor I precursor, partial [Oncorhynchus kisutch] 8019 Oncorhynchus kisutch 116 1 33.8834 76 4.46337 14 18 27 51 23 47 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1109 gi|1190375806|ref|XP_020838022.1| XP_020838022 insulin-like growth factor I isoform X8 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 165 1 34.6538 78 4.46988 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 1110 gi|984094531|ref|XP_015338333.1| XP_015338333 PREDICTED: insulin-like growth factor I isoform X4 [Marmota marmota marmota] 9994 Marmota marmota marmota gi|183120|gb|AAA52543.1| AAA52543 insulin-like growth factor I precursor [Homo sapiens] 9606 Homo sapiens gi|224884|prf||1203258A 1203258A insulin-like growth factor I 9606 Homo sapiens 130 1 33.8834 76 4.47512 14 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1111 gi|545828016|ref|XP_005664256.1| XP_005664256 insulin-like growth factor I isoform X7 [Sus scrofa] 9823 Sus scrofa gi|353468867|gb|AER08610.1| AER08610 insulin-like growth factor 1 precursor transcript variant 7 [Sus scrofa] 9823 Sus scrofa 137 1 34.2686 77 4.49873 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1112 gnl|mdb|bmrb20053:1 bmrb20053:1 Insulin_A-chain_variant_peptide 17 1 33.113 74 4.4994 15 15 1 15 3 17 15 0 GIVEQCCTSICSLYQ GIVEQCCTSICSLYQ GIVEQCCTSICSLYQ 1113 gi|60830818|gb|AAX36946.1| AAX36946 insulin-like growth factor 1, partial [synthetic construct] 32630 synthetic construct 138 1 34.2686 77 4.51953 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1114 gi|47523588|ref|NP_999421.1| NP_999421 insulin-like growth factor I precursor [Sus scrofa] 9823 Sus scrofa gi|164474|gb|AAA31043.1| AAA31043 insulin-like growth factor I precursor [Sus scrofa] 9823 Sus scrofa 130 1 33.8834 76 4.52244 14 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1115 gi|918578264|ref|XP_013374254.1| XP_013374254 PREDICTED: insulin-like growth factor I isoform X2 [Chinchilla lanigera] 34839 Chinchilla lanigera gi|918578266|ref|XP_013374258.1| XP_013374258 PREDICTED: insulin-like growth factor I isoform X2 [Chinchilla lanigera] 34839 Chinchilla lanigera gi|918578268|ref|XP_013374262.1| XP_013374262 PREDICTED: insulin-like growth factor I isoform X2 [Chinchilla lanigera] 34839 Chinchilla lanigera gi|918578270|ref|XP_013374265.1| XP_013374265 PREDICTED: insulin-like growth factor I isoform X2 [Chinchilla lanigera] 34839 Chinchilla lanigera gi|918578272|ref|XP_013374267.1| XP_013374267 PREDICTED: insulin-like growth factor I isoform X2 [Chinchilla lanigera] 34839 Chinchilla lanigera gi|918578274|ref|XP_013374270.1| XP_013374270 PREDICTED: insulin-like growth factor I isoform X2 [Chinchilla lanigera] 34839 Chinchilla lanigera gi|918578276|ref|XP_013374275.1| XP_013374275 PREDICTED: insulin-like growth factor I isoform X2 [Chinchilla lanigera] 34839 Chinchilla lanigera 130 1 33.8834 76 4.52244 14 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1116 gi|1708432|sp|P51458.1|IGF1_HORSE P51458 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 9796 Equus caballus gi|881509|gb|AAA68952.1| AAA68952 insulin-like growth factor precursor, partial [Equus caballus] 9796 Equus caballus 122 1 33.8834 76 4.54031 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1117 gi|61363122|gb|AAX42339.1| AAX42339 insulin-like growth factor 1 [synthetic construct] 32630 synthetic construct 137 1 34.2686 77 4.54599 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1118 gi|110704217|gb|ABG88024.1| ABG88024 class 2 insulin-like growth factor I [Sus scrofa] 9823 Sus scrofa 137 1 34.2686 77 4.54599 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1119 gi|167782080|gb|ACA00157.1| ACA00157 insulin-like growth factor [Branchiostoma belcheri tsingtauense] 155462 Branchiostoma belcheri tsingtauense 307 1 35.4242 80 4.56107 11 16 1 21 81 101 21 0 GIVEQCCTSICSLYQLENYCN GLVEECCLNVCDYSHLESYCN G+VE+CC ++C LE+YCN 1120 gi|1364249|emb|CAA36296.1| CAA36296 unnamed protein product [Sus scrofa] 9823 Sus scrofa 52 1 33.113 74 4.56786 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1121 gi|1126162242|ref|XP_019634794.1| XP_019634794 PREDICTED: insulin-like peptide isoform X3 [Branchiostoma belcheri] 7741 Branchiostoma belcheri gi|1126162244|ref|XP_019634802.1| XP_019634802 PREDICTED: insulin-like peptide isoform X3 [Branchiostoma belcheri] 7741 Branchiostoma belcheri gi|1126162246|ref|XP_019634809.1| XP_019634809 PREDICTED: insulin-like peptide isoform X3 [Branchiostoma belcheri] 7741 Branchiostoma belcheri gi|1126162248|ref|XP_019634817.1| XP_019634817 PREDICTED: insulin-like peptide isoform X3 [Branchiostoma belcheri] 7741 Branchiostoma belcheri gi|1126162250|ref|XP_019634824.1| XP_019634824 PREDICTED: insulin-like peptide isoform X3 [Branchiostoma belcheri] 7741 Branchiostoma belcheri 309 1 35.4242 80 4.57888 11 16 1 21 81 101 21 0 GIVEQCCTSICSLYQLENYCN GLVEECCLNVCDYSHLESYCN G+VE+CC ++C LE+YCN 1122 gi|1016717649|ref|XP_016078699.1| XP_016078699 PREDICTED: insulin-like growth factor I isoform X2 [Miniopterus natalensis] 291302 Miniopterus natalensis 137 1 34.2686 77 4.59375 15 22 13 46 23 56 34 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF LLTLASPASAGPETLCGAELVDALQFVCGDRGFY L L + + + LCG+ LV+AL VCG+RGF+ 1123 gi|560919771|ref|XP_006186105.1| XP_006186105 PREDICTED: insulin-like growth factor I isoform X4 [Camelus ferus] 419612 Camelus ferus gi|560967156|ref|XP_006205961.1| XP_006205961 PREDICTED: insulin-like growth factor I isoform X4 [Vicugna pacos] 30538 Vicugna pacos gi|743733757|ref|XP_010961108.1| XP_010961108 PREDICTED: insulin-like growth factor I isoform X5 [Camelus bactrianus] 9837 Camelus bactrianus 137 1 34.2686 77 4.59375 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1124 gi|374082376|gb|AEY81358.1| AEY81358 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus gi|374082388|gb|AEY81364.1| AEY81364 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus 153 1 34.2686 77 4.63488 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1125 gi|357061814|gb|AET50991.1| AET50991 insulin-like growth factor 1 [Gallus gallus] 9031 Gallus gallus gi|374082382|gb|AEY81361.1| AEY81361 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus 153 1 34.2686 77 4.63488 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1126 gi|1012269914|ref|XP_015982543.1| XP_015982543 PREDICTED: insulin-like growth factor I isoform X3 [Rousettus aegyptiacus] 9407 Rousettus aegyptiacus 137 1 34.2686 77 4.642 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1127 gi|1101606619|ref|XP_018967676.1| XP_018967676 PREDICTED: insulin-like growth factor II isoform X2 [Cyprinus carpio] 7962 Cyprinus carpio 172 1 34.6538 78 4.65278 14 19 25 51 16 42 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDALQFVCGDRGFYFSRPT + LCG LV+AL VCG+RGF+ + T 1128 gi|73977755|ref|XP_866935.1| XP_866935 insulin-like growth factor I isoform X3 [Canis lupus familiaris] 9615 Canis lupus familiaris 137 1 34.2686 77 4.69076 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1129 gi|634880460|ref|XP_007950578.1| XP_007950578 PREDICTED: insulin-like growth factor I isoform X2 [Orycteropus afer afer] 1230840 Orycteropus afer afer 137 1 34.2686 77 4.69076 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1130 gi|504155480|ref|XP_004589656.1| XP_004589656 PREDICTED: insulin-like growth factor I isoform X2 [Ochotona princeps] 9978 Ochotona princeps 137 1 34.2686 77 4.69076 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1131 gi|471366580|ref|XP_004373823.1| XP_004373823 insulin-like growth factor I isoform X4 [Trichechus manatus latirostris] 127582 Trichechus manatus latirostris 137 1 34.2686 77 4.69076 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1132 gi|21064933|gb|AAM29121.1| AAM29121 insulin-like growth factor 1, partial [Vulpes lagopus] 494514 Vulpes lagopus gi|21064935|gb|AAM29122.1| AAM29122 insulin-like growth factor 1, partial [Nyctereutes procyonoides] 34880 Nyctereutes procyonoides gi|21064937|gb|AAM29123.1| AAM29123 insulin-like growth factor 1, partial [Vulpes vulpes] 9627 Vulpes vulpes 43 1 33.113 74 4.69412 13 18 25 46 22 43 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1133 gi|554578333|ref|XP_005880773.1| XP_005880773 PREDICTED: insulin-like growth factor I isoform X2 [Myotis brandtii] 109478 Myotis brandtii gi|558104069|ref|XP_006084134.1| XP_006084134 insulin-like growth factor I isoform X2 [Myotis lucifugus] 59463 Myotis lucifugus 171 1 34.6538 78 4.70836 14 19 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1134 gi|357061812|gb|AET50990.1| AET50990 insulin-like growth factor 1 [Gallus gallus] 9031 Gallus gallus gi|357061816|gb|AET50992.1| AET50992 insulin-like growth factor 1 [Gallus gallus] 9031 Gallus gallus gi|374082380|gb|AEY81360.1| AEY81360 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus gi|374082384|gb|AEY81362.1| AEY81362 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus 153 1 34.2686 77 4.73057 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1135 gi|1126162240|ref|XP_019634785.1| XP_019634785 PREDICTED: insulin-like peptide isoform X2 [Branchiostoma belcheri] 7741 Branchiostoma belcheri 328 1 35.4242 80 4.73754 11 16 1 21 100 120 21 0 GIVEQCCTSICSLYQLENYCN GLVEECCLNVCDYSHLESYCN G+VE+CC ++C LE+YCN 1136 gi|1375012085|ref|XP_024435207.1| XP_024435207 insulin-like growth factor I isoform X4 [Desmodus rotundus] 9430 Desmodus rotundus 137 1 34.2686 77 4.74002 14 18 27 51 37 61 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1137 gi|554578339|ref|XP_005880776.1| XP_005880776 PREDICTED: insulin-like growth factor I isoform X5 [Myotis brandtii] 109478 Myotis brandtii gi|558104083|ref|XP_006084137.1| XP_006084137 insulin-like growth factor I isoform X4 [Myotis lucifugus] 59463 Myotis lucifugus 137 1 34.2686 77 4.74002 14 18 27 51 37 61 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1138 gi|704547485|ref|XP_010178632.1| XP_010178632 PREDICTED: insulin-like growth factor I, partial [Mesitornis unicolor] 54374 Mesitornis unicolor 73 1 33.113 74 4.76026 13 18 25 46 51 72 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1139 gi|222092509|gb|ACM43291.1| ACM43291 insulin growth factor I [Cynoglossus semilaevis] 244447 Cynoglossus semilaevis 187 1 34.6538 78 4.76144 14 19 25 51 48 74 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1140 gi|659928096|ref|NP_001281127.1| NP_001281127 insulin-like growth factor I precursor [Cynoglossus semilaevis] 244447 Cynoglossus semilaevis gi|347466407|gb|AEO97319.1| AEO97319 insulin-like growth factor 1 [Cynoglossus semilaevis] 244447 Cynoglossus semilaevis gi|891070719|gb|AKQ62922.1| AKQ62922 insulin-like growth factor I [Cynoglossus semilaevis] 244447 Cynoglossus semilaevis 187 1 34.6538 78 4.76144 14 19 25 51 48 74 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1141 gi|60654179|gb|AAX29782.1| AAX29782 insulin-like growth factor 1, partial [synthetic construct] 32630 synthetic construct 138 1 34.2686 77 4.76165 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1142 gi|49037298|gb|AAT48996.1| AAT48996 insulin-like growth factor I, partial [Rhabdosargus sarba] 182642 Rhabdosargus sarba 67 1 33.113 74 4.77163 15 20 10 46 4 40 37 0 ICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFF LCVLTLTPTATGASPETLCGAELVDTLQFVCGERGFY +C L + LCG+ LV+ L VCGERGF+ 1143 gi|1048405019|ref|XP_017536877.1| XP_017536877 PREDICTED: insulin-like growth factor I isoform X5 [Manis javanica] 9974 Manis javanica 137 1 34.2686 77 4.7898 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1144 gi|478487395|ref|XP_004418091.1| XP_004418091 PREDICTED: insulin-like growth factor I isoform X5 [Ceratotherium simum simum] 73337 Ceratotherium simum simum 137 1 34.2686 77 4.7898 14 18 27 51 37 61 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1145 gi|642116285|emb|CDQ67588.1| CDQ67588 unnamed protein product [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss 718 1 35.4242 80 4.80262 13 14 1 20 597 616 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCLKACDLQHLESYC GIVEQCC C L LE+YC 1146 gi|586481260|ref|XP_006871151.1| XP_006871151 PREDICTED: insulin-like growth factor I isoform X2 [Chrysochloris asiatica] 185453 Chrysochloris asiatica 137 1 34.2686 77 4.8401 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1147 gi|1328716266|ref|XP_023394729.1| XP_023394729 insulin-like growth factor I isoform X2 [Loxodonta africana] 9785 Loxodonta africana 157 1 34.2686 77 4.84857 14 19 25 51 55 81 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1148 gi|33021|emb|CAA27152.1| CAA27152 unnamed protein product, partial [Homo sapiens] 9606 Homo sapiens 50 1 33.113 74 4.8529 13 18 25 46 28 49 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1149 gi|637300335|ref|XP_008108776.1| XP_008108776 PREDICTED: insulin-like growth factor I isoform X1 [Anolis carolinensis] 28377 Anolis carolinensis 181 1 34.6538 78 4.86655 14 19 25 48 52 75 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGAELVDALQFVCGERGFYFS + LCG+ LV+AL VCGERGF+ + 1150 gi|731231827|ref|XP_010629652.1| XP_010629652 PREDICTED: insulin-like growth factor I isoform X3 [Fukomys damarensis] 885580 Fukomys damarensis 253 1 35.039 79 4.87069 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1151 gi|573890727|ref|XP_006633124.1| XP_006633124 PREDICTED: insulin-like growth factor I isoform X3 [Lepisosteus oculatus] 7918 Lepisosteus oculatus 148 1 34.2686 77 4.87993 15 19 23 51 47 75 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VPETLCGAELVDTLQFVCGERGFYFNKPT V + LCG+ LV+ L VCGERGF+ T 1152 gi|585668932|ref|XP_006888607.1| XP_006888607 PREDICTED: insulin-like growth factor I isoform X2 [Elephantulus edwardii] 28737 Elephantulus edwardii 137 1 34.2686 77 4.89093 14 18 27 51 37 61 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1153 gi|1126162238|ref|XP_019634779.1| XP_019634779 PREDICTED: insulin-like peptide isoform X1 [Branchiostoma belcheri] 7741 Branchiostoma belcheri 355 1 35.4242 80 4.93418 11 16 1 21 127 147 21 0 GIVEQCCTSICSLYQLENYCN GLVEECCLNVCDYSHLESYCN G+VE+CC ++C LE+YCN 1154 gi|1123948048|ref|XP_019587746.1| XP_019587746 PREDICTED: insulin-like growth factor I isoform X5 [Rhinolophus sinicus] 89399 Rhinolophus sinicus 137 1 34.2686 77 4.94228 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1155 gi|488509463|ref|XP_004446868.1| XP_004446868 insulin-like growth factor I isoform X4 [Dasypus novemcinctus] 9361 Dasypus novemcinctus 137 1 34.2686 77 4.94228 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1156 gi|472387809|ref|XP_004413241.1| XP_004413241 PREDICTED: insulin-like growth factor I isoform X6 [Odobenus rosmarus divergens] 9708 Odobenus rosmarus divergens gi|545205797|ref|XP_005606529.1| XP_005606529 insulin-like growth factor I isoform X4 [Equus caballus] 9796 Equus caballus gi|664717740|ref|XP_008515873.1| XP_008515873 PREDICTED: insulin-like growth factor I isoform X5 [Equus przewalskii] 9798 Equus przewalskii gi|759102955|ref|XP_011385149.1| XP_011385149 insulin-like growth factor I isoform X4 [Pteropus vampyrus] 132908 Pteropus vampyrus gi|958822291|ref|XP_014690514.1| XP_014690514 PREDICTED: insulin-like growth factor I isoform X5 [Equus asinus] 9793 Equus asinus 137 1 34.2686 77 4.94228 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1157 gi|1131277596|ref|XP_019816750.1| XP_019816750 PREDICTED: insulin-like growth factor I isoform X9 [Bos indicus] 9915 Bos indicus gi|1387266924|ref|XP_024847110.1| XP_024847110 insulin-like growth factor I isoform X6 [Bos taurus] 9913 Bos taurus 143 1 34.2686 77 5.01089 13 18 25 46 52 73 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1158 gi|640807813|ref|XP_008060412.1| XP_008060412 insulin-like growth factor I isoform X4 [Carlito syrichta] 1868482 Carlito syrichta 153 1 34.2686 77 5.02949 13 17 27 46 53 72 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1159 gi|1034579374|ref|XP_016874748.1| XP_016874748 insulin-like growth factor I isoform X1 [Homo sapiens] 9606 Homo sapiens 212 1 34.6538 78 5.06388 14 19 25 51 68 94 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1160 gi|556950739|ref|XP_005987748.1| XP_005987748 PREDICTED: insulin-like growth factor I [Latimeria chalumnae] 7897 Latimeria chalumnae 203 1 34.6538 78 5.06484 14 18 25 48 51 74 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGSELVDTLQFVCGERGFYFS + LCGS LV+ L VCGERGF+ + 1161 gi|984094529|ref|XP_015338332.1| XP_015338332 PREDICTED: insulin-like growth factor I isoform X3 [Marmota marmota marmota] 9994 Marmota marmota marmota 136 1 33.8834 76 5.07595 13 18 25 46 28 49 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1162 gi|47218323|emb|CAG04155.1| CAG04155 unnamed protein product, partial [Tetraodon nigroviridis] 99883 Tetraodon nigroviridis 125 1 33.8834 76 5.08744 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1163 gi|1121804756|ref|XP_019507447.1| XP_019507447 PREDICTED: insulin-like growth factor I isoform X4 [Hipposideros armiger] 186990 Hipposideros armiger 137 1 33.8834 76 5.09958 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1164 gi|1104882837|ref|XP_019064073.1| XP_019064073 PREDICTED: insulin-like growth factor I isoform X2 [Fukomys damarensis] 885580 Fukomys damarensis 137 1 33.8834 76 5.09958 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1165 gi|861436365|ref|XP_012927717.1| XP_012927717 insulin-like growth factor I isoform X2 [Heterocephalus glaber] 10181 Heterocephalus glaber 137 1 33.8834 76 5.09958 13 18 25 46 35 56 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1166 gi|1229748275|gb|AST35660.1| AST35660 insulin-like growth factor 1, partial [Ochotona princeps] 9978 Ochotona princeps 113 1 33.4982 75 5.13077 13 18 25 46 30 51 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1167 gi|507929113|ref|XP_004675804.1| XP_004675804 PREDICTED: insulin-like growth factor I isoform X2 [Condylura cristata] 143302 Condylura cristata 153 1 34.2686 77 5.18589 14 18 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1168 gi|410965380|ref|XP_003989227.1| XP_003989227 insulin-like growth factor I isoform X4 [Felis catus] 9685 Felis catus gi|1111117755|ref|XP_019302158.1| XP_019302158 PREDICTED: insulin-like growth factor I isoform X5 [Panthera pardus] 9691 Panthera pardus 137 1 33.8834 76 5.20719 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1169 gi|195549249|gb|ACG49835.1| ACG49835 insulin-like growth factor I, partial [Ovis aries] 9940 Ovis aries 150 1 34.2686 77 5.21324 14 19 25 51 48 74 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1170 gi|507636353|ref|XP_004700407.1| XP_004700407 PREDICTED: insulin-like growth factor I isoform X2 [Echinops telfairi] 9371 Echinops telfairi 131 1 33.8834 76 5.21391 13 17 27 46 31 50 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1171 gi|213441|gb|AAB59948.1| AAB59948 insulin-like growth factor I precursor, partial [Oncorhynchus kisutch] 8019 Oncorhynchus kisutch 143 1 34.2686 77 5.22293 14 18 27 51 23 47 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1172 gi|1367157903|ref|XP_016779545.2| XP_016779545 insulin-like growth factor I isoform X1 [Pan troglodytes] 9598 Pan troglodytes 213 1 34.6538 78 5.23272 14 19 25 51 68 94 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1173 gi|1126162252|ref|XP_019634833.1| XP_019634833 PREDICTED: insulin-like peptide isoform X4 [Branchiostoma belcheri] 7741 Branchiostoma belcheri 285 1 35.039 79 5.25056 11 16 1 21 127 147 21 0 GIVEQCCTSICSLYQLENYCN GLVEECCLNVCDYSHLESYCN G+VE+CC ++C LE+YCN 1174 gi|1244081592|ref|XP_022350668.1| XP_022350668 insulin-like growth factor I isoform X3 [Enhydra lutris kenyoni] 391180 Enhydra lutris kenyoni 137 1 33.8834 76 5.26185 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1175 gi|618857402|ref|NP_001166437.2| NP_001166437 insulin-like growth factor I precursor [Cavia porcellus] 10141 Cavia porcellus 137 1 33.8834 76 5.26185 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1176 gi|163637687|gb|ABY27564.1| ABY27564 preproinsulin-like growth factor-I [Odontesthes bonariensis] 219752 Odontesthes bonariensis 185 1 34.6538 78 5.29081 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1177 gi|641707923|ref|XP_008142970.1| XP_008142970 PREDICTED: insulin-like growth factor I isoform X2 [Eptesicus fuscus] 29078 Eptesicus fuscus 153 1 34.2686 77 5.29281 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1178 gi|55976413|sp|Q6IVA5.2|IGF1_AILFU Q6IVA5 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 9649 Ailurus fulgens gi|62510781|sp|Q68LC0.1|IGF1_RHIRO Q68LC0 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 61622 Rhinopithecus roxellana gi|51173053|gb|AAT97354.1| AAT97354 insulin-like growth factor I precursor [Rhinopithecus roxellana] 61622 Rhinopithecus roxellana gi|51511746|gb|AAT40413.2| AAT40413 insulin-like growth factor I precursor [Ailurus fulgens] 9649 Ailurus fulgens 153 1 34.2686 77 5.34708 14 18 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1179 gi|505777622|ref|XP_004602834.1| XP_004602834 PREDICTED: insulin-like growth factor I isoform X3 [Sorex araneus] 42254 Sorex araneus 153 1 34.2686 77 5.34708 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1180 gi|594622373|ref|XP_007165842.1| XP_007165842 PREDICTED: insulin-like growth factor I isoform X1 [Balaenoptera acutorostrata scammoni] 310752 Balaenoptera acutorostrata scammoni 187 1 34.6538 78 5.35263 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1181 gi|124266|sp|P22618.1|IGF_MYXGL P22618 RecName: Full=Insulin-like growth factor; Short=IGF; Flags: Precursor 7769 Myxine glutinosa gi|213202|gb|AAA49265.1| AAA49265 insulin-like growth factor, partial [Myxine glutinosa] 7769 Myxine glutinosa 139 1 33.8834 76 5.41931 14 16 27 49 43 65 23 0 LCGSHLVEALYLVCGERGFFXTP LCGSELVDTLQFVCDDRGFFFVP LCGS LV+ L VC +RGFF P 1182 gi|1176314684|ref|XP_020660088.1| XP_020660088 insulin-like growth factor I isoform X1 [Pogona vitticeps] 103695 Pogona vitticeps 166 1 34.2686 77 5.45591 14 19 25 48 52 75 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGAELVDALQFVCGERGFYFS + LCG+ LV+AL VCGERGF+ + 1183 gi|829805560|ref|XP_012628133.1| XP_012628133 insulin-like growth factor I isoform X1 [Microcebus murinus] 30608 Microcebus murinus 153 1 34.2686 77 5.45729 14 18 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1184 gi|395819961|ref|XP_003783346.1| XP_003783346 insulin-like growth factor I isoform X1 [Otolemur garnettii] 30611 Otolemur garnettii 153 1 34.2686 77 5.45729 13 17 27 46 53 72 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1185 gi|852728954|ref|XP_012875610.1| XP_012875610 PREDICTED: insulin-like growth factor I isoform X3 [Dipodomys ordii] 10020 Dipodomys ordii 137 1 33.8834 76 5.48621 13 17 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1186 gi|226148|prf||1412252A 1412252A insulin A 8018 Oncorhynchus keta gi|228832|prf||1812293A 1812293A insulin:SUBUNIT=A 7933 Anguilliformes 21 1 32.7278 73 5.49543 13 17 1 21 1 21 21 0 GIVEQCCTSICSLYQLENYCN GIVEQCCHKPCNIFDLQNYCN GIVEQCC C+++ L+NYCN 1187 gi|608604956|gb|AHW50883.1| AHW50883 insulin-like growth factor 1, partial [Girella laevifrons] 326166 Girella laevifrons 143 1 33.8834 76 5.50051 14 18 27 51 30 54 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1188 gi|1191877818|ref|XP_020946799.1| XP_020946799 insulin-like growth factor I isoform X6 [Sus scrofa] 9823 Sus scrofa gi|353468861|gb|AER08607.1| AER08607 insulin-like growth factor 1 precursor transcript variant 4 [Sus scrofa] 9823 Sus scrofa 147 1 34.2686 77 5.50771 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1189 gi|1016717647|ref|XP_016078698.1| XP_016078698 PREDICTED: insulin-like growth factor I isoform X1 [Miniopterus natalensis] 291302 Miniopterus natalensis 153 1 34.2686 77 5.56974 16 23 13 51 39 77 39 0 LYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFXTPXT LLTLASPASAGPETLCGAELVDALQFVCGDRGFYFNKPT L L + + + LCG+ LV+AL VCG+RGF+ T 1190 gi|586481258|ref|XP_006871150.1| XP_006871150 PREDICTED: insulin-like growth factor I isoform X1 [Chrysochloris asiatica] 185453 Chrysochloris asiatica 153 1 34.2686 77 5.62682 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1191 gi|585158147|ref|XP_006731370.1| XP_006731370 PREDICTED: insulin-like growth factor I isoform X1 [Leptonychotes weddellii] 9713 Leptonychotes weddellii gi|1212186059|ref|XP_021543250.1| XP_021543250 insulin-like growth factor I isoform X2 [Neomonachus schauinslandi] 29088 Monachus schauinslandi 153 1 34.2686 77 5.62682 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1192 gi|803030715|ref|XP_012015032.1| XP_012015032 PREDICTED: insulin-like growth factor I isoform X1 [Ovis aries] 9940 Ovis aries 153 1 34.2686 77 5.62682 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1193 gi|655741667|ref|XP_008254941.1| XP_008254941 PREDICTED: insulin-like growth factor I isoform X4 [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 153 1 34.2686 77 5.62682 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1194 gi|554578337|ref|XP_005880775.1| XP_005880775 PREDICTED: insulin-like growth factor I isoform X4 [Myotis brandtii] 109478 Myotis brandtii gi|558104078|ref|XP_006084136.1| XP_006084136 insulin-like growth factor I isoform X3 [Myotis lucifugus] 59463 Myotis lucifugus 153 1 34.2686 77 5.62682 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1195 gi|5103031|dbj|BAA78767.1| BAA78767 IGF1, partial [Mesocricetus auratus] 10036 Mesocricetus auratus 88 1 33.113 74 5.6374 13 17 25 46 13 34 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGPRGFY + LCG+ LV+AL VCG RGF+ 1196 gi|455|emb|CAA33746.1| CAA33746 prepro-insulin-like growth factor I, partial [Bos taurus] 9913 Bos taurus 153 1 34.2686 77 5.68448 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1197 gi|826310576|ref|XP_012505713.1| XP_012505713 PREDICTED: insulin-like growth factor I [Propithecus coquereli] 379532 Propithecus coquereli 208 1 34.6538 78 5.69787 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1198 gi|1212186057|ref|XP_021543249.1| XP_021543249 insulin-like growth factor I isoform X1 [Neomonachus schauinslandi] 29088 Monachus schauinslandi 185 1 34.6538 78 5.72064 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1199 gi|13358513|ref|NP_078716.1| NP_078716 hypothetical protein LCDV1gp068 [Lymphocystis disease virus 1] 36363 Lymphocystis disease virus 1 80 1 33.113 74 5.75259 14 16 27 51 22 46 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCSAHLVAALQRVCGNRGVYRPPPT LC +HLV AL VCG RG + P T 1200 gi|972982284|ref|XP_015207419.1| XP_015207419 PREDICTED: insulin-like growth factor I isoform X1 [Lepisosteus oculatus] 7918 Lepisosteus oculatus gi|972982286|ref|XP_015207420.1| XP_015207420 PREDICTED: insulin-like growth factor I isoform X1 [Lepisosteus oculatus] 7918 Lepisosteus oculatus 160 1 34.2686 77 5.76201 15 19 23 51 47 75 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VPETLCGAELVDTLQFVCGERGFYFNKPT V + LCG+ LV+ L VCGERGF+ T 1201 gi|1375012083|ref|XP_024435205.1| XP_024435205 insulin-like growth factor I isoform X3 [Desmodus rotundus] 9430 Desmodus rotundus 153 1 34.2686 77 5.80156 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1202 gi|667309743|ref|XP_008584170.1| XP_008584170 PREDICTED: insulin-like growth factor I isoform X2 [Galeopterus variegatus] 482537 Galeopterus variegatus 153 1 34.2686 77 5.80156 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1203 gi|556779596|ref|XP_005984847.1| XP_005984847 PREDICTED: insulin-like growth factor I isoform X6 [Pantholops hodgsonii] 59538 Pantholops hodgsonii 153 1 34.2686 77 5.80156 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1204 gi|56435|emb|CAA29436.1| CAA29436 IGF-IA precursor, partial [Rattus norvegicus] 10116 Rattus norvegicus 108 1 33.4982 75 5.83083 13 17 25 46 6 27 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGPRGFY + LCG+ LV+AL VCG RGF+ 1205 gi|528949346|ref|XP_005206554.1| XP_005206554 insulin-like growth factor I isoform X5 [Bos taurus] 9913 Bos taurus gi|555973355|ref|XP_005898674.1| XP_005898674 PREDICTED: insulin-like growth factor I isoform X6 [Bos mutus] 72004 Bos mutus gi|594069965|ref|XP_006058875.1| XP_006058875 PREDICTED: insulin-like growth factor I isoform X7 [Bubalus bubalis] 89462 Bubalus bubalis gi|742176924|ref|XP_010851731.1| XP_010851731 PREDICTED: insulin-like growth factor I isoform X6 [Bison bison bison] 43346 Bison bison bison gi|1131277592|ref|XP_019816749.1| XP_019816749 PREDICTED: insulin-like growth factor I isoform X8 [Bos indicus] 9915 Bos indicus 153 1 34.2686 77 5.86099 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1206 gi|972982288|ref|XP_015207421.1| XP_015207421 PREDICTED: insulin-like growth factor I isoform X2 [Lepisosteus oculatus] 7918 Lepisosteus oculatus 160 1 34.2686 77 5.87936 15 19 23 51 47 75 29 0 VNQHLCGSHLVEALYLVCGERGFFXTPXT VPETLCGAELVDTLQFVCGERGFYFNKPT V + LCG+ LV+ L VCGERGF+ T 1207 gi|488155|gb|AAA18212.1| AAA18212 insulin-like growth factor I, partial [Salmo salar] 8030 Salmo salar 117 1 33.4982 75 5.90999 14 18 27 51 23 47 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1208 gi|1244081590|ref|XP_022350667.1| XP_022350667 insulin-like growth factor I isoform X2 [Enhydra lutris kenyoni] 391180 Enhydra lutris kenyoni gi|218139467|gb|ACK57890.1| ACK57890 insulin-like growth factor I [Neovison vison] 452646 Neovison vison 153 1 34.2686 77 5.92102 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1209 gi|507616883|ref|XP_004623904.1| XP_004623904 insulin-like growth factor I isoform X1 [Octodon degus] 10160 Octodon degus 153 1 34.2686 77 5.92102 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1210 gi|1129985161|ref|XP_019749267.1| XP_019749267 PREDICTED: LOW QUALITY PROTEIN: insulin-like growth factor I [Hippocampus comes] 109280 Hippocampus comes 149 1 33.8834 76 5.94486 14 19 25 51 48 74 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1211 gi|167508949|gb|ABZ81613.1| ABZ81613 insulin-like growth factor 1, partial [Amphiprion clarkii] 80970 Amphiprion clarkii 65 1 32.7278 73 5.96737 13 17 25 46 17 38 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDTLQFVCGERGFY + LCG+ LV+ L VCGERGF+ 1212 gi|585668928|ref|XP_006888606.1| XP_006888606 PREDICTED: insulin-like growth factor I isoform X1 [Elephantulus edwardii] 28737 Elephantulus edwardii 153 1 34.2686 77 5.98166 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1213 gi|634880457|ref|XP_007950577.1| XP_007950577 PREDICTED: insulin-like growth factor I isoform X1 [Orycteropus afer afer] 1230840 Orycteropus afer afer 153 1 34.2686 77 5.98166 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1214 gi|548466851|ref|XP_005680594.1| XP_005680594 PREDICTED: insulin-like growth factor I isoform X6 [Capra hircus] 9925 Capra hircus 153 1 34.2686 77 5.98166 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1215 gi|1391555109|ref|XP_025026995.1| XP_025026995 insulin-like growth factor I isoform X2 [Python bivittatus] 176946 Python bivittatus 144 1 33.8834 76 5.99385 13 17 27 46 32 51 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1216 gi|85002114|gb|ABC68459.1| ABC68459 insulin-like growth factor-1, partial [Symphysodon aequifasciata] 74133 Symphysodon aequifasciata 97 1 33.113 74 6.02335 13 17 25 46 22 43 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDTLQFVCGERGFY + LCG+ LV+ L VCGERGF+ 1217 gi|1187578236|ref|XP_020736515.1| XP_020736515 insulin-like growth factor I isoform X2 [Odocoileus virginianus texanus] 9880 Odocoileus virginianus texanus 153 1 34.2686 77 6.04291 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1218 gi|545828013|ref|XP_005664255.1| XP_005664255 insulin-like growth factor I isoform X5 [Sus scrofa] 9823 Sus scrofa gi|124251|sp|P16545.1|IGF1_PIG P16545 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 9823 Sus scrofa gi|71034457|gb|AAZ20129.1| AAZ20129 insulin-like growth factor I precursor [Sus scrofa] 9823 Sus scrofa gi|353468855|gb|AER08604.1| AER08604 insulin-like growth factor 1 precursor transcript variant 1 [Sus scrofa] 9823 Sus scrofa gi|417346652|gb|AFX60086.1| AFX60086 insulin-like growth factor I [Sus scrofa] 9823 Sus scrofa gi|417346669|gb|AFX60087.1| AFX60087 insulin-like growth factor I [Sus scrofa] 9823 Sus scrofa 153 1 34.2686 77 6.04291 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1219 gi|511836958|ref|XP_004743052.1| XP_004743052 PREDICTED: insulin-like growth factor I isoform X3 [Mustela putorius furo] 9669 Mustela putorius furo 153 1 34.2686 77 6.04291 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1220 gi|478487393|ref|XP_004418090.1| XP_004418090 PREDICTED: insulin-like growth factor I isoform X4 [Ceratotherium simum simum] 73337 Ceratotherium simum simum 153 1 34.2686 77 6.04291 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1221 gi|466007414|ref|XP_004269502.1| XP_004269502 PREDICTED: insulin-like growth factor I isoform X4 [Orcinus orca] 9733 Orcinus orca gi|470635293|ref|XP_004323175.1| XP_004323175 PREDICTED: insulin-like growth factor I isoform X1 [Tursiops truncatus] 9739 Tursiops truncatus gi|1246218091|ref|XP_022455544.1| XP_022455544 insulin-like growth factor I isoform X4 [Delphinapterus leucas] 9749 Delphinapterus leucas gi|1378908139|ref|XP_024587965.1| XP_024587965 insulin-like growth factor I isoform X6 [Neophocaena asiaeorientalis asiaeorientalis] 1706337 Neophocaena asiaeorientalis asiaeorientalis 153 1 34.2686 77 6.04291 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1222 gnl|mdb|bmrb20052:1 bmrb20052:1 Human_Insulin_A-chain_peptide 15 1 32.7278 73 6.07035 15 15 1 15 1 15 15 0 GIVEQCCTSICSLYQ GIVEQCCTSICSLYQ GIVEQCCTSICSLYQ 1223 gi|752389692|ref|XP_011218339.1| XP_011218339 PREDICTED: insulin-like growth factor I isoform X1 [Ailuropoda melanoleuca] 9646 Ailuropoda melanoleuca 187 1 34.2686 77 6.07527 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1224 gi|155969721|ref|NP_001075967.2| NP_001075967 insulin-like growth factor I precursor [Equus caballus] 9796 Equus caballus gi|301759313|ref|XP_002915500.1| XP_002915500 PREDICTED: insulin-like growth factor I isoform X4 [Ailuropoda melanoleuca] 9646 Ailuropoda melanoleuca gi|472387805|ref|XP_004413239.1| XP_004413239 PREDICTED: insulin-like growth factor I isoform X4 [Odobenus rosmarus divergens] 9708 Odobenus rosmarus divergens gi|664717738|ref|XP_008515872.1| XP_008515872 PREDICTED: insulin-like growth factor I isoform X4 [Equus przewalskii] 9798 Equus przewalskii gi|759102952|ref|XP_011385143.1| XP_011385143 insulin-like growth factor I isoform X3 [Pteropus vampyrus] 132908 Pteropus vampyrus gi|958822288|ref|XP_014690513.1| XP_014690513 PREDICTED: insulin-like growth factor I isoform X4 [Equus asinus] 9793 Equus asinus gi|62510784|sp|Q6JLX1.2|IGF1_AILME Q6JLX1 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 9646 Ailuropoda melanoleuca gi|48995461|gb|AAQ83972.2| AAQ83972 insulin-like growth factor I precursor [Ailuropoda melanoleuca] 9646 Ailuropoda melanoleuca gi|154089546|gb|ABS57177.1| ABS57177 insulin-like growth factor 1 [Equus caballus] 9796 Equus caballus 153 1 34.2686 77 6.10478 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1225 gi|1123948046|ref|XP_019587745.1| XP_019587745 PREDICTED: insulin-like growth factor I isoform X4 [Rhinolophus sinicus] 89399 Rhinolophus sinicus 153 1 34.2686 77 6.10478 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1226 gi|731457528|ref|XP_010598061.1| XP_010598061 insulin-like growth factor I isoform X3 [Loxodonta africana] 9785 Loxodonta africana 153 1 34.2686 77 6.10478 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1227 gi|593751350|ref|XP_007130866.1| XP_007130866 insulin-like growth factor I isoform X4 [Physeter catodon] 9755 Physeter catodon 153 1 34.2686 77 6.10478 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1228 gi|533118282|ref|XP_005374628.1| XP_005374628 PREDICTED: insulin-like growth factor I isoform X1 [Chinchilla lanigera] 34839 Chinchilla lanigera 153 1 33.8834 76 6.16728 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1229 gi|488509460|ref|XP_004446867.1| XP_004446867 insulin-like growth factor I isoform X2 [Dasypus novemcinctus] 9361 Dasypus novemcinctus 153 1 33.8834 76 6.16728 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1230 gi|1048405017|ref|XP_017536871.1| XP_017536871 PREDICTED: insulin-like growth factor I isoform X4 [Manis javanica] 9974 Manis javanica 153 1 33.8834 76 6.23041 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1231 gi|11024682|ref|NP_000609.1| NP_000609 insulin-like growth factor I isoform 4 preproprotein [Homo sapiens] 9606 Homo sapiens gi|386781670|ref|NP_001247655.1| NP_001247655 insulin-like growth factor I precursor [Macaca mulatta] 9544 Macaca mulatta gi|114646563|ref|XP_001156521.1| XP_001156521 insulin-like growth factor I isoform X7 [Pan troglodytes] 9598 Pan troglodytes gi|332241624|ref|XP_003269978.1| XP_003269978 PREDICTED: insulin-like growth factor I isoform X3 [Nomascus leucogenys] 61853 Nomascus leucogenys gi|402887435|ref|XP_003907099.1| XP_003907099 insulin-like growth factor I isoform X2 [Papio anubis] 9555 Papio anubis gi|426373896|ref|XP_004053822.1| XP_004053822 PREDICTED: insulin-like growth factor I isoform X4 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla gi|532073200|ref|XP_005322410.1| XP_005322410 insulin-like growth factor I isoform X2 [Ictidomys tridecemlineatus] 43179 Ictidomys tridecemlineatus gi|544472487|ref|XP_005572097.1| XP_005572097 PREDICTED: insulin-like growth factor I isoform X2 [Macaca fascicularis] 9541 Macaca fascicularis gi|635067659|ref|XP_008002633.1| XP_008002633 PREDICTED: insulin-like growth factor I isoform X3 [Chlorocebus sabaeus] 60711 Chlorocebus sabaeus gi|675800437|ref|XP_008956266.1| XP_008956266 insulin-like growth factor I isoform X4 [Pan paniscus] 9597 Pan paniscus gi|724963737|ref|XP_010355574.1| XP_010355574 PREDICTED: insulin-like growth factor I isoform X4 [Rhinopithecus roxellana] 61622 Rhinopithecus roxellana gi|795311387|ref|XP_011824033.1| XP_011824033 PREDICTED: insulin-like growth factor I isoform X4 [Mandrillus leucophaeus] 9568 Mandrillus leucophaeus gi|795427546|ref|XP_011760043.1| XP_011760043 insulin-like growth factor I isoform X2 [Macaca nemestrina] 9545 Macaca nemestrina gi|795456340|ref|XP_011888071.1| XP_011888071 PREDICTED: insulin-like growth factor I isoform X4 [Cercocebus atys] 9531 Cercocebus atys gi|984094527|ref|XP_015338331.1| XP_015338331 PREDICTED: insulin-like growth factor I isoform X2 [Marmota marmota marmota] 9994 Marmota marmota marmota gi|1059185477|ref|XP_017748949.1| XP_017748949 PREDICTED: insulin-like growth factor I isoform X4 [Rhinopithecus bieti] 61621 Rhinopithecus bieti gi|32990|emb|CAA40092.1| CAA40092 IGF-1a [Homo sapiens] 9606 Homo sapiens gi|33008|emb|CAA40342.1| CAA40342 insulin-like growth factor I [Homo sapiens] 9606 Homo sapiens gi|33016|emb|CAA24998.1| CAA24998 insulin-like growth factor 1A precursor [Homo sapiens] 9606 Homo sapiens gi|183110|gb|AAA52538.1| AAA52538 insulin-like growth factor precursor IA [Homo sapiens] 9606 Homo sapiens gi|306927|gb|AAA52787.1| AAA52787 insulin-like growth factor precursor [Homo sapiens] 9606 Homo sapiens gi|29501804|gb|AAO74829.1| AAO74829 insulin-like growth factor 1 (somatomedin C) [Homo sapiens] 9606 Homo sapiens gi|49456677|emb|CAG46659.1| CAG46659 IGF1 [Homo sapiens] 9606 Homo sapiens gi|54781363|gb|AAV40833.1| AAV40833 insulin-like growth factor 1 (somatomedin C) [Homo sapiens] 9606 Homo sapiens gi|60821664|gb|AAX36582.1| AAX36582 insulin-like growth factor 1 [synthetic construct] 32630 synthetic construct gi|119618104|gb|EAW97698.1| EAW97698 insulin-like growth factor 1 (somatomedin C), isoform CRA_d [Homo sapiens] 9606 Homo sapiens gi|156229709|gb|AAI52322.1| AAI52322 Insulin-like growth factor 1 (somatomedin C) [Homo sapiens] 9606 Homo sapiens gi|168277504|dbj|BAG10730.1| BAG10730 insulin-like growth factor IA precursor, partial [synthetic construct] 32630 synthetic construct gi|182888113|gb|AAI60082.1| AAI60082 Insulin-like growth factor 1 (somatomedin C) [synthetic construct] 32630 synthetic construct gi|189053365|dbj|BAG35164.1| BAG35164 unnamed protein product [Homo sapiens] 9606 Homo sapiens gi|1331805688|gb|PNI65120.1| PNI65120 IGF1 isoform 1 [Pan troglodytes] 9598 Pan troglodytes 153 1 33.8834 76 6.23041 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1232 gi|674049313|ref|XP_008830828.1| XP_008830828 PREDICTED: insulin-like growth factor I isoform X2 [Nannospalax galili] 1026970 Nannospalax galili 153 1 33.8834 76 6.23041 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1233 gi|602684152|ref|XP_007454330.1| XP_007454330 PREDICTED: insulin-like growth factor I isoform X3 [Lipotes vexillifer] 118797 Lipotes vexillifer 153 1 33.8834 76 6.23041 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1234 gi|560919769|ref|XP_006186104.1| XP_006186104 PREDICTED: insulin-like growth factor I isoform X3 [Camelus ferus] 419612 Camelus ferus gi|560967154|ref|XP_006205960.1| XP_006205960 PREDICTED: insulin-like growth factor I isoform X3 [Vicugna pacos] 30538 Vicugna pacos gi|743733755|ref|XP_010961107.1| XP_010961107 PREDICTED: insulin-like growth factor I isoform X4 [Camelus bactrianus] 9837 Camelus bactrianus gi|744594377|ref|XP_010988323.1| XP_010988323 PREDICTED: insulin-like growth factor I isoform X3 [Camelus dromedarius] 9838 Camelus dromedarius 153 1 33.8834 76 6.23041 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1235 gi|297692763|ref|XP_002823705.1| XP_002823705 insulin-like growth factor I isoform X3 [Pongo abelii] 9601 Pongo abelii gi|795095464|ref|XP_011790435.1| XP_011790435 PREDICTED: insulin-like growth factor I isoform X4 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus gi|1297583457|ref|XP_023044760.1| XP_023044760 insulin-like growth factor I isoform X4 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles gi|1331935275|gb|PNJ83162.1| PNJ83162 IGF1 isoform 1 [Pongo abelii] 9601 Pongo abelii 153 1 33.8834 76 6.23041 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1236 gi|597470810|gb|AHN09793.1| AHN09793 insulin-like growth factor-1, partial [Thunnus maccoyii] 8240 Thunnus maccoyii 149 1 33.8834 76 6.25749 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1237 gi|593751346|ref|XP_007130864.1| XP_007130864 insulin-like growth factor I isoform X2 [Physeter catodon] 9755 Physeter catodon 186 1 34.2686 77 6.28129 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1238 gi|189098255|gb|ACD76651.1| ACD76651 insulin-like growth factor 1 [Ochotona curzoniae] 130825 Ochotona curzoniae 153 1 33.8834 76 6.29418 13 18 25 46 51 72 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1239 gi|471366578|ref|XP_004373822.1| XP_004373822 insulin-like growth factor I isoform X3 [Trichechus manatus latirostris] 127582 Trichechus manatus latirostris 153 1 33.8834 76 6.29418 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1240 gi|110704215|gb|ABG88023.1| ABG88023 class 1 insulin-like growth factor I [Sus scrofa] 9823 Sus scrofa 153 1 33.8834 76 6.29418 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1241 gi|1187578242|ref|XP_020736531.1| XP_020736531 insulin-like growth factor I isoform X5 [Odocoileus virginianus texanus] 9880 Odocoileus virginianus texanus 187 1 34.2686 77 6.31647 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1242 gi|7532878|gb|AAF63265.1| AAF63265 insulin-like growth factor 1, partial [Carassius auratus] 7957 Carassius auratus 62 1 32.7278 73 6.37211 13 19 25 51 2 28 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGDRGFYFSKPT + LCG+ LV+ L VCG+RGF+ + T 1243 gi|655741558|ref|XP_008254938.1| XP_008254938 PREDICTED: insulin-like growth factor I isoform X1 [Oryctolagus cuniculus] 9986 Oryctolagus cuniculus 187 1 34.2686 77 6.37824 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1244 gi|478487387|ref|XP_004418087.1| XP_004418087 PREDICTED: insulin-like growth factor I isoform X1 [Ceratotherium simum simum] 73337 Ceratotherium simum simum 187 1 34.2686 77 6.37824 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1245 gi|902731|emb|CAA90412.1| CAA90412 insulin-like growth factor I [Squalus acanthias] 7797 Squalus acanthias 126 1 33.4982 75 6.38699 13 17 27 46 29 48 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1246 gi|472387807|ref|XP_004413240.1| XP_004413240 PREDICTED: insulin-like growth factor I isoform X5 [Odobenus rosmarus divergens] 9708 Odobenus rosmarus divergens 145 1 33.8834 76 6.39481 13 17 27 46 45 64 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGDRGFY LCG+ LV+AL VCG+RGF+ 1247 gi|1121804752|ref|XP_019507446.1| XP_019507446 PREDICTED: insulin-like growth factor I isoform X3 [Hipposideros armiger] 186990 Hipposideros armiger 153 1 33.8834 76 6.42366 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1248 gi|697497467|ref|XP_009678278.1| XP_009678278 PREDICTED: insulin-like growth factor I isoform X1 [Struthio camelus australis] 441894 Struthio camelus australis 248 1 34.6538 78 6.43658 14 19 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFSKPT LCG+ LV+AL VCG+RGF+ + T 1249 gi|617624130|ref|XP_007527986.1| XP_007527986 PREDICTED: insulin-like growth factor I isoform X2 [Erinaceus europaeus] 9365 Erinaceus europaeus 153 1 33.8834 76 6.48938 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1250 gi|594622379|ref|XP_007165845.1| XP_007165845 PREDICTED: insulin-like growth factor I isoform X4 [Balaenoptera acutorostrata scammoni] 310752 Balaenoptera acutorostrata scammoni 153 1 33.8834 76 6.48938 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1251 gi|456496680|gb|AGG38005.1| AGG38005 insulin-like growth factor I [Gallus gallus] 9031 Gallus gallus 153 1 33.8834 76 6.48938 14 18 27 51 53 77 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDALQFVCGDRGFYFNKPT LCG+ LV+AL VCG+RGF+ T 1252 gi|410965378|ref|XP_003989226.1| XP_003989226 insulin-like growth factor I isoform X3 [Felis catus] 9685 Felis catus gi|987411014|ref|XP_015394597.1| XP_015394597 PREDICTED: insulin-like growth factor I [Panthera tigris altaica] 74533 Panthera tigris altaica gi|1111117753|ref|XP_019302157.1| XP_019302157 PREDICTED: insulin-like growth factor I isoform X4 [Panthera pardus] 9691 Panthera pardus gi|55976406|sp|Q6GUL6.2|IGF1_PANTA Q6GUL6 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 74533 Panthera tigris altaica gi|51511737|gb|AAT48655.2| AAT48655 insulin-like growth factor I precursor [Panthera tigris altaica] 74533 Panthera tigris altaica 153 1 33.8834 76 6.62283 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1253 gi|925114778|ref|NP_001300784.1| NP_001300784 insulin-like growth factor I precursor [Canis lupus familiaris] 9615 Canis lupus familiaris gi|187608877|sp|P33712.2|IGF1_CANFA P33712 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Somatomedin; Flags: Precursor 9615 Canis lupus familiaris gi|165882444|gb|ABY71545.1| ABY71545 insulin-like growth factor 1 [Vulpes lagopus] 494514 Vulpes lagopus 153 1 33.8834 76 6.62283 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1254 gi|554589292|ref|XP_005885993.1| XP_005885993 PREDICTED: insulin-like growth factor II [Myotis brandtii] 109478 Myotis brandtii 181 1 34.2686 77 6.65931 13 18 24 48 29 53 25 0 NQHLCGSHLVEALYLVCGERGFFXT SETLCGGELVDTLQFVCGDRGFYLT ++ LCG LV+ L VCG+RGF+ T 1255 gi|300836866|gb|ADK38548.1| ADK38548 insulin-like growth factor I preprohormone [Sciaenops ocellatus] 76340 Sciaenops ocellatus 147 1 33.8834 76 6.69609 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1256 gi|1131277564|ref|XP_019816743.1| XP_019816743 PREDICTED: insulin-like growth factor I isoform X2 [Bos indicus] 9915 Bos indicus 187 1 34.2686 77 6.69616 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1257 gi|594069955|ref|XP_006058870.1| XP_006058870 PREDICTED: insulin-like growth factor I isoform X2 [Bubalus bubalis] 89462 Bubalus bubalis 187 1 34.2686 77 6.69616 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1258 gi|555973347|ref|XP_005898670.1| XP_005898670 PREDICTED: insulin-like growth factor I isoform X2 [Bos mutus] 72004 Bos mutus gi|742176912|ref|XP_010851727.1| XP_010851727 PREDICTED: insulin-like growth factor I isoform X2 [Bison bison bison] 43346 Bison bison bison gi|982925526|ref|XP_015326548.1| XP_015326548 insulin-like growth factor I isoform X2 [Bos taurus] 9913 Bos taurus gi|440903717|gb|ELR54342.1| ELR54342 Insulin-like growth factor I [Bos mutus] 72004 Bos mutus 187 1 34.2686 77 6.69616 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1259 gi|831318609|ref|XP_012692055.1| XP_012692055 PREDICTED: insulin-like growth factor II [Clupea harengus] 7950 Clupea harengus 266 1 34.6538 78 6.70833 12 17 25 48 53 76 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGGELVDTLQFICGERGFYFS + LCG LV+ L +CGERGF+ + 1260 gi|1131277554|ref|XP_019816741.1| XP_019816741 PREDICTED: insulin-like growth factor I isoform X1 [Bos indicus] 9915 Bos indicus gi|1131277560|ref|XP_019816742.1| XP_019816742 PREDICTED: insulin-like growth factor I isoform X1 [Bos indicus] 9915 Bos indicus 188 1 34.2686 77 6.73258 14 19 25 51 52 78 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1261 gi|555973345|ref|XP_005898669.1| XP_005898669 PREDICTED: insulin-like growth factor I isoform X1 [Bos mutus] 72004 Bos mutus gi|742176908|ref|XP_010851726.1| XP_010851726 PREDICTED: insulin-like growth factor I isoform X1 [Bison bison bison] 43346 Bison bison bison gi|982925521|ref|XP_015326547.1| XP_015326547 insulin-like growth factor I isoform X1 [Bos taurus] 9913 Bos taurus gi|326703749|gb|AEA06508.1| AEA06508 insulin-like growth factor I variant 2 [Bos taurus] 9913 Bos taurus 188 1 34.2686 77 6.73258 14 19 25 51 52 78 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1262 gi|1169034379|ref|XP_020469445.1| XP_020469445 insulin-like growth factor II [Monopterus albus] 43700 Monopterus albus 215 1 34.2686 77 6.76476 14 19 25 51 53 79 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDALQFVCGDRGFYFSRPT + LCG LV+AL VCG+RGF+ + T 1263 gi|1168918463|ref|XP_020502239.1| XP_020502239 insulin-like growth factor I isoform X2 [Labrus bergylta] 56723 Labrus bergylta 168 1 34.2686 77 6.77281 14 19 25 51 29 55 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1264 gi|594069953|ref|XP_006058869.1| XP_006058869 PREDICTED: insulin-like growth factor I isoform X1 [Bubalus bubalis] 89462 Bubalus bubalis 188 1 34.2686 77 6.79832 14 19 25 51 52 78 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1265 gi|219524765|gb|ACL14947.1| ACL14947 insulin-like growth factor I, partial [Scophthalmus maximus] 52904 Scophthalmus maximus 151 1 33.8834 76 6.81281 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1266 gi|1160111411|ref|XP_020383027.1| XP_020383027 insulin-like growth factor II [Rhincodon typus] 259920 Rhincodon typus 210 1 34.2686 77 6.82726 14 18 25 51 52 78 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDTLQFVCGERGFYFSRAT + LCG LV+ L VCGERGF+ + T 1267 gi|1123948040|ref|XP_019587741.1| XP_019587741 PREDICTED: insulin-like growth factor I isoform X1 [Rhinolophus sinicus] 89399 Rhinolophus sinicus 187 1 34.2686 77 6.82768 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1268 gi|556779588|ref|XP_005984843.1| XP_005984843 PREDICTED: insulin-like growth factor I isoform X2 [Pantholops hodgsonii] 59538 Pantholops hodgsonii 187 1 34.2686 77 6.82768 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1269 gi|545205791|ref|XP_005606526.1| XP_005606526 insulin-like growth factor I isoform X1 [Equus caballus] 9796 Equus caballus gi|664717732|ref|XP_008515867.1| XP_008515867 PREDICTED: insulin-like growth factor I isoform X1 [Equus przewalskii] 9798 Equus przewalskii 187 1 34.2686 77 6.82768 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1270 gi|472387799|ref|XP_004413236.1| XP_004413236 PREDICTED: insulin-like growth factor I isoform X1 [Odobenus rosmarus divergens] 9708 Odobenus rosmarus divergens 187 1 34.2686 77 6.82768 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1271 gi|731231825|ref|XP_010629651.1| XP_010629651 PREDICTED: insulin-like growth factor I isoform X1 [Fukomys damarensis] 885580 Fukomys damarensis 153 1 33.8834 76 6.8281 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1272 gi|512965378|ref|XP_004844899.1| XP_004844899 insulin-like growth factor I isoform X1 [Heterocephalus glaber] 10181 Heterocephalus glaber 153 1 33.8834 76 6.8281 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1273 gi|165874103|gb|ABY68229.1| ABY68229 insulin-like growth factor I, partial [Amphiprion ocellaris] 80972 Amphiprion ocellaris 70 1 32.7278 73 6.85096 13 17 25 46 22 43 22 0 QHLCGSHLVEALYLVCGERGFF RPLCGAELVDTLQFVCGERGFY + LCG+ LV+ L VCGERGF+ 1274 gi|556779586|ref|XP_005984842.1| XP_005984842 PREDICTED: insulin-like growth factor I isoform X1 [Pantholops hodgsonii] 59538 Pantholops hodgsonii 188 1 34.2686 77 6.86469 14 19 25 51 52 78 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1275 gi|189098253|gb|ACD76650.1| ACD76650 insulin-like growth factor 1 [Eospalax fontanierii baileyi] 146132 Eospalax baileyi 153 1 33.8834 76 6.89791 13 18 25 46 51 72 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1276 gi|504155478|ref|XP_004589655.1| XP_004589655 PREDICTED: insulin-like growth factor I isoform X1 [Ochotona princeps] 9978 Ochotona princeps 153 1 33.8834 76 6.89791 13 18 25 46 51 72 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1277 gi|637300342|ref|XP_008108777.1| XP_008108777 PREDICTED: insulin-like growth factor I isoform X2 [Anolis carolinensis] 28377 Anolis carolinensis 166 1 33.8834 76 7.0024 14 19 25 48 52 75 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGAELVDALQFVCGERGFYFS + LCG+ LV+AL VCGERGF+ + 1278 gi|336111778|gb|AEI16549.1| AEI16549 insulin-like growth factor I, partial [Chelon labrosus] 48171 Chelon labrosus 170 1 34.2686 77 7.01814 13 19 25 51 31 57 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ZTLCGAELVDTLQFVCGDRGFYFSKPT + LCG+ LV+ L VCG+RGF+ + T 1279 gi|1020399631|ref|XP_016151253.1| XP_016151253 PREDICTED: insulin-like growth factor I isoform X2 [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 228 1 34.2686 77 7.0239 13 14 1 20 89 108 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCVRGCDLQHLESYC GIVEQCC C L LE+YC 1280 gi|344267652|ref|XP_003405680.1| XP_003405680 insulin-like growth factor I isoform X1 [Loxodonta africana] 9785 Loxodonta africana 210 1 34.2686 77 7.02637 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1281 gi|808884492|gb|KKF31429.1| KKF31429 Insulin-like growth factor I, partial [Larimichthys crocea] 215358 Larimichthys crocea 173 1 34.2686 77 7.03559 14 19 25 51 34 60 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1282 gi|852728952|ref|XP_012875602.1| XP_012875602 PREDICTED: insulin-like growth factor I isoform X2 [Dipodomys ordii] 10020 Dipodomys ordii 153 1 33.8834 76 7.03965 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1283 gi|1020399629|ref|XP_016151245.1| XP_016151245 PREDICTED: insulin-like growth factor I isoform X1 [Sinocyclocheilus grahami] 75366 Sinocyclocheilus grahami 229 1 34.2686 77 7.04808 13 14 1 20 90 109 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCVRGCDLQHLESYC GIVEQCC C L LE+YC 1284 gi|505777619|ref|XP_004602833.1| XP_004602833 PREDICTED: insulin-like growth factor I isoform X1 [Sorex araneus] 42254 Sorex araneus 167 1 33.8834 76 7.13121 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1285 gi|584049386|ref|XP_006769420.1| XP_006769420 PREDICTED: insulin-like growth factor I isoform X2 [Myotis davidii] 225400 Myotis davidii 171 1 34.2686 77 7.14187 15 18 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGSELVYALQFVCGDRGFYFNKPT + LCGS LV AL VCG+RGF+ T 1286 gi|26332433|dbj|BAC29934.1| BAC29934 unnamed protein product [Mus musculus] 10090 Mus musculus 165 1 33.8834 76 7.2261 14 18 25 51 35 61 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGPRGFYFNKPT + LCG+ LV+AL VCG RGF+ T 1287 gi|1101606617|ref|XP_018967675.1| XP_018967675 PREDICTED: insulin-like growth factor II isoform X1 [Cyprinus carpio] 7962 Cyprinus carpio gi|16551381|gb|AAL25799.1|AF402958_1 AAL25799 prepro-insulin-like growth factor-II [Cyprinus carpio] 7962 Cyprinus carpio gi|966670554|gb|KTG03935.1| KTG03935 hypothetical protein cypCar_00045008 [Cyprinus carpio] 7962 Cyprinus carpio 207 1 34.2686 77 7.28274 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDALQFVCGDRGFYFSRPT + LCG LV+AL VCG+RGF+ + T 1288 gi|213811|gb|AAA18211.1| AAA18211 insulin-like growth factor I, partial [Salmo salar] 8030 Salmo salar 145 1 33.8834 76 7.31121 14 18 27 51 23 47 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1289 gi|1111117741|ref|XP_019302154.1| XP_019302154 PREDICTED: insulin-like growth factor I isoform X1 [Panthera pardus] 9691 Panthera pardus 187 1 34.2686 77 7.37982 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1290 gi|170066878|ref|XP_001868258.1| XP_001868258 conserved hypothetical protein [Culex quinquefasciatus] 7176 Culex quinquefasciatus gi|167863066|gb|EDS26449.1| EDS26449 conserved hypothetical protein [Culex quinquefasciatus] 7176 Culex quinquefasciatus 158 1 33.8834 76 7.49206 13 16 1 24 134 157 24 0 GIVEQCCTSICSLYQLENYCNFVN GIVDECCLRSCSINQLMKYCKTVN GIV++CC CS+ QL YC VN 1291 gi|1211458564|ref|XP_021513803.1| XP_021513803 insulin-like growth factor I isoform X3 [Meriones unguiculatus] 10047 Meriones unguiculatus 143 1 33.8834 76 7.50083 13 16 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGPRGFY LCG+ LV+AL VCG RGF+ 1292 gi|795095443|ref|XP_011790417.1| XP_011790417 PREDICTED: insulin-like growth factor I isoform X1 [Colobus angolensis palliatus] 336983 Colobus angolensis palliatus 208 1 34.2686 77 7.52573 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1293 gi|724963731|ref|XP_010355571.1| XP_010355571 PREDICTED: insulin-like growth factor I isoform X1 [Rhinopithecus roxellana] 61622 Rhinopithecus roxellana gi|1059185471|ref|XP_017748946.1| XP_017748946 PREDICTED: insulin-like growth factor I isoform X1 [Rhinopithecus bieti] 61621 Rhinopithecus bieti gi|1297583431|ref|XP_023044442.1| XP_023044442 insulin-like growth factor I isoform X1 [Piliocolobus tephrosceles] 591936 Piliocolobus tephrosceles 208 1 34.2686 77 7.52573 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1294 gi|1046201385|gb|ANV28181.1| ANV28181 insulin-like growth factor 1, partial [Clarias batrachus] 59899 Clarias batrachus 85 1 32.7278 73 7.62545 13 18 27 51 2 26 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGDRGFYFSKPT LCG+ LV+ L VCG+RGF+ + T 1295 gi|1012269912|ref|XP_015982542.1| XP_015982542 PREDICTED: insulin-like growth factor I isoform X2 [Rousettus aegyptiacus] 9407 Rousettus aegyptiacus 153 1 33.8834 76 7.63598 13 18 25 46 51 72 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDALQFVCGDRGFY + LCG+ LV+AL VCG+RGF+ 1296 gi|4376142|emb|CAA25151.1| CAA25151 unnamed protein product [synthetic construct] 32630 synthetic construct 23 1 32.3426 72 7.68693 13 17 25 45 3 23 21 0 QHLCGSHLVEALYLVCGERGF ETLCGAELVDALQFVCGDRGF + LCG+ LV+AL VCG+RGF 1297 gi|1367157913|ref|XP_024203791.1| XP_024203791 insulin-like growth factor I isoform X4 [Pan troglodytes] 9598 Pan troglodytes 176 1 33.8834 76 7.69525 14 19 25 51 68 94 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1298 gi|1244081588|ref|XP_022350666.1| XP_022350666 insulin-like growth factor I isoform X1 [Enhydra lutris kenyoni] 391180 Enhydra lutris kenyoni 183 1 34.2686 77 7.72632 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1299 gi|635067655|ref|XP_008002630.1| XP_008002630 PREDICTED: insulin-like growth factor I isoform X1 [Chlorocebus sabaeus] 60711 Chlorocebus sabaeus gi|795311360|ref|XP_011824030.1| XP_011824030 PREDICTED: insulin-like growth factor I isoform X1 [Mandrillus leucophaeus] 9568 Mandrillus leucophaeus gi|795456329|ref|XP_011888068.1| XP_011888068 PREDICTED: insulin-like growth factor I isoform X1 [Cercocebus atys] 9531 Cercocebus atys 208 1 34.2686 77 7.74525 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1300 gi|958822278|ref|XP_014690510.1| XP_014690510 PREDICTED: insulin-like growth factor I isoform X1 [Equus asinus] 9793 Equus asinus 187 1 34.2686 77 7.74714 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1301 gi|353468865|gb|AER08609.1| AER08609 insulin-like growth factor 1 precursor transcript variant 6 [Sus scrofa] 9823 Sus scrofa 230 1 34.2686 77 7.85229 14 19 25 51 94 120 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1302 gi|1016717655|ref|XP_016078702.1| XP_016078702 PREDICTED: insulin-like growth factor I isoform X4 [Miniopterus natalensis] 291302 Miniopterus natalensis 187 1 34.2686 77 7.89908 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1303 gi|560919761|ref|XP_006186100.1| XP_006186100 PREDICTED: insulin-like growth factor I isoform X1 [Camelus ferus] 419612 Camelus ferus gi|560967148|ref|XP_006205957.1| XP_006205957 PREDICTED: insulin-like growth factor I isoform X1 [Vicugna pacos] 30538 Vicugna pacos gi|743733749|ref|XP_010961104.1| XP_010961104 PREDICTED: insulin-like growth factor I isoform X1 [Camelus bactrianus] 9837 Camelus bactrianus gi|744594371|ref|XP_010988321.1| XP_010988321 PREDICTED: insulin-like growth factor I isoform X1 [Camelus dromedarius] 9838 Camelus dromedarius 187 1 34.2686 77 7.89908 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1304 gi|548466841|ref|XP_005680589.1| XP_005680589 PREDICTED: insulin-like growth factor I isoform X2 [Capra hircus] 9925 Capra hircus 187 1 34.2686 77 7.89908 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1305 gi|511836952|ref|XP_004743049.1| XP_004743049 PREDICTED: insulin-like growth factor I isoform X1 [Mustela putorius furo] 9669 Mustela putorius furo 187 1 34.2686 77 7.89908 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1306 gi|283826480|gb|ADB43568.1| ADB43568 insulin-like growth factor I [Sus scrofa] 9823 Sus scrofa 187 1 34.2686 77 7.89908 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1307 gi|548466839|ref|XP_005680588.1| XP_005680588 PREDICTED: insulin-like growth factor I isoform X1 [Capra hircus] 9925 Capra hircus 188 1 34.2686 77 7.94083 14 19 25 51 52 78 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1308 gi|379975554|gb|AFD20692.1| AFD20692 insulin-like growth factor I transcript variant 2 [Cervus elaphus] 9860 Cervus elaphus 188 1 34.2686 77 7.94083 14 19 25 51 52 78 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1309 gi|213443|gb|AAA49413.1| AAA49413 insulin-like growth factor I precursor, partial [Oncorhynchus kisutch] 8019 Oncorhynchus kisutch 155 1 33.8834 76 7.95994 14 19 25 51 21 47 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1310 gi|1375012079|ref|XP_024435203.1| XP_024435203 insulin-like growth factor I isoform X1 [Desmodus rotundus] 9430 Desmodus rotundus 187 1 34.2686 77 7.97615 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1311 gi|532030656|ref|XP_005358271.1| XP_005358271 PREDICTED: insulin-like growth factor I isoform X3 [Microtus ochrogaster] 79684 Microtus ochrogaster 143 1 33.4982 75 7.97998 13 16 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGPRGFY LCG+ LV+AL VCG RGF+ 1312 gi|1190375800|ref|XP_020838019.1| XP_020838019 insulin-like growth factor I isoform X5 [Phascolarctos cinereus] 38626 Phascolarctos cinereus 187 1 33.8834 76 8.05397 15 20 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGERGFYFSKPT + LCG+ LV+AL VCGERGF+ + T 1313 gi|1168918461|ref|XP_020502238.1| XP_020502238 insulin-like growth factor I isoform X1 [Labrus bergylta] 56723 Labrus bergylta 186 1 33.8834 76 8.08921 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1314 gi|3687742|gb|AAC62228.1| AAC62228 insulin-like growth factor I [Paralichthys olivaceus] 8255 Paralichthys olivaceus 186 1 33.8834 76 8.08921 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1315 gi|55925786|gb|AAV67967.1| AAV67967 insulin-like growth factor-1 [Dicentrarchus labrax] 13489 Dicentrarchus labrax gi|283137713|gb|ADB12449.1| ADB12449 insulin growth factor 1 [Dicentrarchus labrax] 13489 Dicentrarchus labrax 186 1 33.8834 76 8.08921 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1316 gi|41353205|gb|AAS01183.1| AAS01183 preproinsulin-like growth factor I [Epinephelus coioides] 94232 Epinephelus coioides 186 1 33.8834 76 8.08921 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1317 gi|28848782|gb|AAO47742.1| AAO47742 preproinsulin-like growth factor I [Siganus guttatus] 92439 Siganus guttatus 186 1 33.8834 76 8.08921 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1318 gi|1246218085|ref|XP_022455540.1| XP_022455540 insulin-like growth factor I isoform X1 [Delphinapterus leucas] 9749 Delphinapterus leucas 186 1 33.8834 76 8.16819 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1319 gi|821392958|ref|XP_012388350.1| XP_012388350 PREDICTED: insulin-like growth factor I isoform X1 [Orcinus orca] 9733 Orcinus orca 186 1 33.8834 76 8.16819 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1320 gi|327358467|gb|AEA51080.1| AEA51080 insulin-like growth factor-I, partial [Oryzias melastigma] 30732 Oryzias melastigma 84 1 32.7278 73 8.18342 13 19 25 51 29 55 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGDRGFYFSKPT + LCG+ LV+ L VCG+RGF+ + T 1321 gi|1338740804|ref|XP_023662896.1| XP_023662896 insulin-like growth factor II isoform X2 [Paramormyrops kingsleyae] 1676925 Paramormyrops kingsleyae 183 1 33.8834 76 8.2718 14 19 24 51 23 50 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SETLCGGELVDALQFVCGSRGFYFSRPT ++ LCG LV+AL VCG RGF+ + T 1322 gi|167077135|gb|ABZ10841.1| ABZ10841 insulin-like growth factor Ib [Epinephelus lanceolatus] 310571 Epinephelus lanceolatus 186 1 33.8834 76 8.32846 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1323 gi|740529944|ref|NP_001290263.1| NP_001290263 insulin-like growth factor I precursor [Larimichthys crocea] 215358 Larimichthys crocea gi|1108899087|ref|XP_019112549.1| XP_019112549 PREDICTED: insulin-like growth factor I [Larimichthys crocea] 215358 Larimichthys crocea gi|1143412659|ref|XP_019960503.1| XP_019960503 PREDICTED: insulin-like growth factor I [Paralichthys olivaceus] 8255 Paralichthys olivaceus gi|33089962|gb|AAP93861.1| AAP93861 insulin-like growth factor Ib precursor [Perca flavescens] 8167 Perca flavescens gi|37936473|emb|CAE52915.1| CAE52915 insulin-like growth factor 1 precursor [Perca fluviatilis] 8168 Perca fluviatilis gi|54399798|gb|AAV34198.1| AAV34198 insulin-like growth factor I, partial [Epinephelus coioides] 94232 Epinephelus coioides gi|303387249|gb|ADM15564.1| ADM15564 insulin-like growth factor I Ea-4 [Sciaenops ocellatus] 76340 Sciaenops ocellatus gi|345101182|gb|AEN69454.1| AEN69454 insulin-like growth factor I [Larimichthys crocea] 215358 Larimichthys crocea gi|666420369|dbj|BAP16520.1| BAP16520 insulin-like growth factor I [Epinephelus bruneus] 323802 Epinephelus bruneus gi|808862727|gb|KKF14192.1| KKF14192 Insulin-like growth factor I [Larimichthys crocea] 215358 Larimichthys crocea gi|827352574|gb|AKJ77804.1| AKJ77804 insulin like growth factor-1 isoform Ea4 [Argyrosomus regius] 172269 Argyrosomus regius gi|1009100341|gb|AMR58932.1| AMR58932 insulin-like growth factor I [Epinephelus coioides] 94232 Epinephelus coioides 186 1 33.8834 76 8.32846 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1324 gi|602684148|ref|XP_007454328.1| XP_007454328 PREDICTED: insulin-like growth factor I isoform X1 [Lipotes vexillifer] 118797 Lipotes vexillifer 174 1 33.8834 76 8.37709 14 19 25 51 72 98 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1325 gi|471366576|ref|XP_004373821.1| XP_004373821 insulin-like growth factor I isoform X1 [Trichechus manatus latirostris] 127582 Trichechus manatus latirostris 189 1 33.8834 76 8.37834 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1326 gi|1387740153|gb|PWA30179.1| PWA30179 hypothetical protein CCH79_00014934, partial [Gambusia affinis] 33528 Gambusia affinis 68 1 32.3426 72 8.40012 13 17 25 46 47 68 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDTLQFVCGERGFY + LCG+ LV+ L VCGERGF+ 1327 gi|1158884476|ref|XP_020346545.1| XP_020346545 insulin-like growth factor I isoform X4 [Oncorhynchus kisutch] 8019 Oncorhynchus kisutch 149 1 33.4982 75 8.41881 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1328 gi|929105313|ref|XP_014063821.1| XP_014063821 PREDICTED: insulin-like growth factor I isoform X5 [Salmo salar] 8030 Salmo salar 149 1 33.4982 75 8.41881 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1329 gi|1034579380|ref|XP_016874751.1| XP_016874751 insulin-like growth factor I isoform X3 [Homo sapiens] 9606 Homo sapiens 175 1 33.8834 76 8.43358 14 19 25 51 68 94 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1330 gi|1367495170|ref|XP_024231228.1| XP_024231228 insulin-like growth factor I, adult form [Oncorhynchus tshawytscha] 74940 Oncorhynchus tshawytscha 214 1 34.2686 77 8.477 13 14 1 20 93 112 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCLKACDLQHLESYC GIVEQCC C L LE+YC 1331 gi|1342947642|ref|XP_023870267.1| XP_023870267 insulin-like growth factor I isoform X3 [Salvelinus alpinus] 8036 Salvelinus alpinus 149 1 33.4982 75 8.50523 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1332 gi|1211268410|ref|XP_021417867.1| XP_021417867 insulin-like growth factor I isoform X2 [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss gi|1211305172|ref|XP_021432853.1| XP_021432853 insulin-like growth factor I isoform X3 [Oncorhynchus mykiss] 8022 Oncorhynchus mykiss gi|1367490274|ref|XP_024228566.1| XP_024228566 insulin-like growth factor I isoform X4 [Oncorhynchus tshawytscha] 74940 Oncorhynchus tshawytscha gi|559011|gb|AAA67268.1| AAA67268 insulin-like growth factor-I [Oncorhynchus tshawytscha] 74940 Oncorhynchus tshawytscha 149 1 33.4982 75 8.50523 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1333 gi|81251397|gb|ABB70043.1| ABB70043 insulin-like growth factor I precursor [Paralichthys lethostigma] 141886 Paralichthys lethostigma 186 1 33.8834 76 8.57471 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1334 gi|929264579|ref|XP_014008803.1| XP_014008803 PREDICTED: insulin-like growth factor I isoform X2 [Salmo salar] 8030 Salmo salar gi|1343046118|ref|XP_023825294.1| XP_023825294 insulin-like growth factor I isoform X3 [Salvelinus alpinus] 8036 Salvelinus alpinus 149 1 33.4982 75 8.59253 14 18 27 51 49 73 25 0 LCGSHLVEALYLVCGERGFFXTPXT LCGAELVDTLQFVCGERGFYFSKPT LCG+ LV+ L VCGERGF+ + T 1335 gi|1354638994|gb|AVK79248.1| AVK79248 insulin-like growth factor 1 [Protonibea diacanthus] 335060 Protonibea diacanthus 186 1 33.8834 76 8.65838 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1336 gi|61744184|gb|AAX55675.1| AAX55675 preproinsulin-like growth factor I, partial [Oreochromis niloticus] 8128 Oreochromis niloticus 132 1 33.4982 75 8.67046 13 17 25 46 47 68 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDTLQFVCGERGFY + LCG+ LV+ L VCGERGF+ 1337 gi|674061415|ref|XP_008837428.1| XP_008837428 PREDICTED: insulin-like growth factor II isoform X1 [Nannospalax galili] 1026970 Nannospalax galili 235 1 34.2686 77 8.77816 13 19 24 51 85 112 28 0 NQHLCGSHLVEALYLVCGERGFFXTPXT SETLCGGELVDTLQFVCGDRGFYFSRPT ++ LCG LV+ L VCG+RGF+ + T 1338 gi|19387530|gb|AAL87235.1|AF481856_1 AAL87235 insulin-like growth factor-I [Sebastes schlegelii] 214486 Sebastes schlegelii 73 1 32.3426 72 8.80145 13 17 25 46 47 68 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDTLQFVCGERGFY + LCG+ LV+ L VCGERGF+ 1339 gi|1250127938|ref|XP_022605480.1| XP_022605480 insulin-like growth factor I [Seriola dumerili] 41447 Seriola dumerili gi|1317126360|ref|XP_023275165.1| XP_023275165 insulin-like growth factor I [Seriola lalandi dorsalis] 1841481 Seriola lalandi dorsalis gi|215421915|dbj|BAG85332.1| BAG85332 insulin-like growth factor I precursor [Seriola quinqueradiata] 8161 Seriola quinqueradiata gi|1203820176|gb|ARX70256.1| ARX70256 insulin-like growth factor 1 [Seriola lalandi] 302047 Seriola lalandi 185 1 33.8834 76 8.86672 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1340 gi|545828004|ref|XP_005664252.1| XP_005664252 insulin-like growth factor I isoform X1 [Sus scrofa] 9823 Sus scrofa gi|353468857|gb|AER08605.1| AER08605 insulin-like growth factor 1 precursor transcript variant 2 [Sus scrofa] 9823 Sus scrofa 187 1 33.8834 76 8.87474 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1341 gi|472368672|ref|XP_004403860.1| XP_004403860 PREDICTED: LOW QUALITY PROTEIN: insulin-like growth factor II [Odobenus rosmarus divergens] 9708 Odobenus rosmarus divergens 198 1 33.8834 76 8.91299 12 18 24 48 31 55 25 0 NQHLCGSHLVEALYLVCGERGFFXT SETLCGGELVDTLQFVCGDRGFYFS ++ LCG LV+ L VCG+RGF+ + 1342 gi|1043392599|gb|ANS54009.1| ANS54009 insulin-like growth factor-I protein [Pampus argenteus] 206143 Pampus argenteus 201 1 33.8834 76 8.94312 14 19 25 51 62 88 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1343 gi|1158913610|ref|XP_020361825.1| XP_020361825 insulin-like growth factor I, adult form [Oncorhynchus kisutch] 8019 Oncorhynchus kisutch 214 1 34.2686 77 8.97704 13 14 1 20 93 112 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCLKACDLQHLESYC GIVEQCC C L LE+YC 1344 gi|1378908131|ref|XP_024587960.1| XP_024587960 insulin-like growth factor I isoform X2 [Neophocaena asiaeorientalis asiaeorientalis] 1706337 Neophocaena asiaeorientalis asiaeorientalis 186 1 33.8834 76 9.00125 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1345 gi|938064461|gb|KPP65374.1| KPP65374 hypothetical protein Z043_116216 [Scleropages formosus] 113540 Scleropages formosus 119 1 33.113 74 9.04054 13 17 25 46 34 55 22 0 QHLCGSHLVEALYLVCGERGFF ETLCGAELVDTLQFVCGERGFY + LCG+ LV+ L VCGERGF+ 1346 gi|1048405011|ref|XP_017536852.1| XP_017536852 PREDICTED: insulin-like growth factor I isoform X1 [Manis javanica] 9974 Manis javanica 187 1 33.8834 76 9.04857 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1347 gi|565311787|gb|ETE64550.1| ETE64550 Insulin-like growth factor II [Ophiophagus hannah] 8665 Ophiophagus hannah 185 1 33.8834 76 9.21807 13 17 25 48 29 52 24 0 QHLCGSHLVEALYLVCGERGFFXT ETLCGGELVDTLQFVCGERGFYFS + LCG LV+ L VCGERGF+ + 1348 gi|51807|emb|CAA28170.1| CAA28170 unnamed protein product [Mus musculus] 10090 Mus musculus gi|15214569|gb|AAH12409.1| AAH12409 Insulin-like growth factor 1 [Mus musculus] 10090 Mus musculus gi|71060055|emb|CAJ18571.1| CAJ18571 Igf1 [Mus musculus] 10090 Mus musculus 133 1 33.113 74 9.2751 13 16 27 46 27 46 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGPRGFY LCG+ LV+AL VCG RGF+ 1349 gi|532030660|ref|XP_005358273.1| XP_005358273 PREDICTED: insulin-like growth factor I isoform X5 [Microtus ochrogaster] 79684 Microtus ochrogaster gi|913503374|ref|XP_013205800.1| XP_013205800 PREDICTED: insulin-like growth factor I isoform X5 [Microtus ochrogaster] 79684 Microtus ochrogaster 136 1 33.4982 75 9.29635 13 16 27 46 30 49 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGPRGFY LCG+ LV+AL VCG RGF+ 1350 gi|163659889|ref|NP_001104744.1| NP_001104744 insulin-like growth factor I isoform 3 precursor [Mus musculus] 10090 Mus musculus gi|1039732194|ref|XP_017169300.1| XP_017169300 PREDICTED: insulin-like growth factor I isoform X8 [Mus musculus] 10090 Mus musculus gi|1039732196|ref|XP_017169301.1| XP_017169301 PREDICTED: insulin-like growth factor I isoform X8 [Mus musculus] 10090 Mus musculus 143 1 33.4982 75 9.31446 13 16 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGPRGFY LCG+ LV+AL VCG RGF+ 1351 gi|1195559486|ref|XP_021060921.1| XP_021060921 insulin-like growth factor I isoform X3 [Mus pahari] 10093 Mus pahari 143 1 33.4982 75 9.4109 13 16 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGPRGFY LCG+ LV+AL VCG RGF+ 1352 gi|37993620|gb|AAR06904.1| AAR06904 insulin-like growth factor II, partial [Mugil cephalus] 48193 Mugil cephalus 188 1 33.8834 76 9.45464 14 19 25 51 53 79 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGGELVDALQFVCGDRGFYFSRPT + LCG LV+AL VCG+RGF+ + T 1353 gi|1389776782|ref|XP_024945766.1| XP_024945766 insulin-like growth factor I isoform X1 [Cephus cinctus] 211228 Cephus cinctus 232 1 34.2686 77 9.46844 13 16 1 20 82 101 20 0 GIVEQCCTSICSLYQLENYC GLVEECCYNPCSLEQLEAYC G+VE+CC + CSL QLE YC 1354 gi|1101550275|ref|XP_018941047.1| XP_018941047 PREDICTED: insulin-like growth factor I isoform X3 [Cyprinus carpio] 7962 Cyprinus carpio 183 1 33.8834 76 9.47968 13 14 1 20 74 93 20 0 GIVEQCCTSICSLYQLENYC GIVEQCCVRGCDLQHLESYC GIVEQCC C L LE+YC 1355 gi|163659903|ref|NP_001104755.1| NP_001104755 insulin-like growth factor I isoform 3 preproprotein [Homo sapiens] 9606 Homo sapiens gi|124263|sp|P05019.1|IGF1_HUMAN P05019 RecName: Full=Insulin-like growth factor I; Short=IGF-I; AltName: Full=Mechano growth factor; Short=MGF; AltName: Full=Somatomedin-C; Flags: Precursor 9606 Homo sapiens gi|32992|emb|CAA40093.1| CAA40093 IGF-1b [Homo sapiens] 9606 Homo sapiens gi|183109|gb|AAA52537.1| AAA52537 insulin-like growth factor IB [Homo sapiens] 9606 Homo sapiens gi|183112|gb|AAA52539.1| AAA52539 insulin-like growth factor IB prepropeptide [Homo sapiens] 9606 Homo sapiens gi|60819671|gb|AAX36508.1| AAX36508 insulin-like growth factor 1 [synthetic construct] 32630 synthetic construct gi|119618102|gb|EAW97696.1| EAW97696 insulin-like growth factor 1 (somatomedin C), isoform CRA_b [Homo sapiens] 9606 Homo sapiens gi|187955846|gb|AAI48267.1| AAI48267 IGF1 protein [Homo sapiens] 9606 Homo sapiens 195 1 33.8834 76 9.68301 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1356 gi|327202229|gb|AEA36762.1| AEA36762 insulin-like growth factor I, partial [Gadus morhua] 8049 Gadus morhua 180 1 33.8834 76 9.68968 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1357 gi|1214035121|ref|XP_021570240.1| XP_021570240 insulin-like growth factor I isoform X3 [Carlito syrichta] 1868482 Carlito syrichta 159 1 33.4982 75 9.72567 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1358 gi|1211458566|ref|XP_021513804.1| XP_021513804 insulin-like growth factor I isoform X4 [Meriones unguiculatus] 10047 Meriones unguiculatus 137 1 33.113 74 9.72829 13 16 27 46 37 56 20 0 LCGSHLVEALYLVCGERGFF LCGAELVDALQFVCGPRGFY LCG+ LV+AL VCG RGF+ 1359 gi|298566234|ref|NP_001177291.1| NP_001177291 insulin-like growth factor I precursor [Takifugu rubripes] 31033 Takifugu rubripes gi|209838090|dbj|BAG75453.1| BAG75453 insulin-like growth factor-1 [Takifugu rubripes] 31033 Takifugu rubripes 182 1 33.8834 76 9.80122 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1360 gi|73544690|gb|AAZ78133.1| AAZ78133 insulin-like growth factor-I, partial [Dicentrarchus labrax] 13489 Dicentrarchus labrax 174 1 33.8834 76 9.80389 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1361 gi|303387253|gb|ADM15566.1| ADM15566 insulin-like growth factor I Ea-3 [Sciaenops ocellatus] 76340 Sciaenops ocellatus 174 1 33.8834 76 9.80389 14 19 25 51 47 73 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFSKPT + LCG+ LV+ L VCGERGF+ + T 1362 gi|60830992|gb|AAX36953.1| AAX36953 insulin-like growth factor 1, partial [synthetic construct] 32630 synthetic construct 196 1 33.8834 76 9.82082 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1363 gi|397525322|ref|XP_003832621.1| XP_003832621 insulin-like growth factor I isoform X1 [Pan paniscus] 9597 Pan paniscus gi|675800433|ref|XP_008956264.1| XP_008956264 insulin-like growth factor I isoform X1 [Pan paniscus] 9597 Pan paniscus gi|686742110|ref|XP_009246437.1| XP_009246437 insulin-like growth factor I isoform X1 [Pongo abelii] 9601 Pongo abelii gi|694951893|ref|XP_009424388.1| XP_009424388 insulin-like growth factor I isoform X2 [Pan troglodytes] 9598 Pan troglodytes gi|821004296|ref|XP_012365599.1| XP_012365599 PREDICTED: insulin-like growth factor I isoform X1 [Nomascus leucogenys] 61853 Nomascus leucogenys gi|1099127603|ref|XP_018894891.1| XP_018894891 PREDICTED: insulin-like growth factor I isoform X1 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla gi|1099127606|ref|XP_018894892.1| XP_018894892 PREDICTED: insulin-like growth factor I isoform X1 [Gorilla gorilla gorilla] 9595 Gorilla gorilla gorilla gi|355564619|gb|EHH21119.1| EHH21119 hypothetical protein EGK_04115, partial [Macaca mulatta] 9544 Macaca mulatta gi|355786457|gb|EHH66640.1| EHH66640 hypothetical protein EGM_03674, partial [Macaca fascicularis] 9541 Macaca fascicularis gi|1331805691|gb|PNI65123.1| PNI65123 IGF1 isoform 4 [Pan troglodytes] 9598 Pan troglodytes gi|1331935278|gb|PNJ83165.1| PNJ83165 IGF1 isoform 4 [Pongo abelii] 9601 Pongo abelii 196 1 33.8834 76 9.82082 14 19 25 51 51 77 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDALQFVCGDRGFYFNKPT + LCG+ LV+AL VCG+RGF+ T 1364 gi|1160126456|ref|XP_020388626.1| XP_020388626 insulin-like growth factor I [Rhincodon typus] 259920 Rhincodon typus 226 1 33.8834 76 9.9196 12 18 23 46 53 76 24 0 VNQHLCGSHLVEALYLVCGERGFF IEETLCGAELVDALQFICAERGFY + + LCG+ LV+AL +C ERGF+ 1365 gi|1007708654|ref|XP_015816830.1| XP_015816830 PREDICTED: insulin-like growth factor I isoform X2 [Nothobranchius furzeri] 105023 Nothobranchius furzeri 172 1 33.8834 76 9.96249 14 18 25 51 34 60 27 0 QHLCGSHLVEALYLVCGERGFFXTPXT ETLCGAELVDTLQFVCGERGFYFNKPT + LCG+ LV+ L VCGERGF+ T 154991815 56768880555 24 1432325078865 0.041 0.267 0.14