BLASTP 2.2.22+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Stephen F. Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. RID: S06NWFFZ112 Query= Length=201 Score E Sequences producing significant alignments: (Bits) Value lcl|32519 unnamed protein product 51.6 9e-12 ALIGNMENTS >lcl|32519 unnamed protein product Length=171 Score = 51.6 bits (122), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 43/163 (26%), Positives = 69/163 (42%), Gaps = 26/163 (15%) Query 34 ILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARR 93 I V + R L DRV VY FD GTVVAE+ E P E Sbjct 15 IFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVA-EGWPQARDQVIEDPCFREHWVE 73 Query 94 LFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLV 153 +R +++ D+ + + CH++ L+ + V ++LV Sbjct 74 AYRQGRIQATTDI------------------------FKAGLTECHLNQLRPLKVRANLV 109 Query 154 VPLMHHQELWGLLVSHHA-EPRPYSQEELQVVQLLADQVSIAI 195 VP++ +L+GLL++H A EPR + + E+ LA S+ + Sbjct 110 VPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVL 152