Chem Shift validation: AVS_full
BMRB Entry DOI: doi:10.13018/BMR51795
NMR-STAR file interactive viewer.
NMR-STAR v3 text file.
XML gzip file.
RDF gzip file.
All files associated with the entry
Citation: Shihora, Aman; Elias, Ruben; Hammond, R.; Ghirlando, Rodolfo; Deshmukh, Lalit. "ALS Variants of Annexin A11's Proline-Rich Domain Impair Its S100A6-Mediated Fibril Dissolution
" ACS Chem. Neurosci. 14, 2583-2589 (2023).
PubMed: 37433222
Assembly members:
entity_1, polymer, 59 residues, Formula weight is not available
Natural source: Common Name: Human Taxonomy ID: 9606 Superkingdom: Eukaryota Kingdom: Metazoa Genus/species: Homo sapiens
Experimental source: Production method: recombinant technology Host organism: Escherichia coli Vector: pET11a
Entity Sequences (FASTA):
entity_1: SYPGYPPPPGGYPPAAPGGG
PWGGAAYPPPPSMPPIGLDN
VATYAGQFNQDWSHPQFEK
| Data type | Count |
| 13C chemical shifts | 148 |
| 15N chemical shifts | 58 |
| 1H chemical shifts | 37 |
| Entity Assembly ID | Entity Name | Entity ID |
|---|---|---|
| 1 | proline-rich domain of Annexin A11 | 1 |
Entity 1, proline-rich domain of Annexin A11 59 residues - Formula weight is not available
The primary seq is as follows: SYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDWSHPQFEK The first residue in the seq is Serine-2. The C-terminal residues (WSHPQFEK) represent non-native strep tag residues used for purification.
| 1 | SER | TYR | PRO | GLY | TYR | PRO | PRO | PRO | PRO | GLY | ||||
| 2 | GLY | TYR | PRO | PRO | ALA | ALA | PRO | GLY | GLY | GLY | ||||
| 3 | PRO | TRP | GLY | GLY | ALA | ALA | TYR | PRO | PRO | PRO | ||||
| 4 | PRO | SER | MET | PRO | PRO | ILE | GLY | LEU | ASP | ASN | ||||
| 5 | VAL | ALA | THR | TYR | ALA | GLY | GLN | PHE | ASN | GLN | ||||
| 6 | ASP | TRP | SER | HIS | PRO | GLN | PHE | GLU | LYS |
sample_1: proline-rich domain of Annexin A11 (residues 2-52), [U-100% 13C; U-100% 15N], 0.2 mM; D2O, [U-2H], 7%; HEPES 25 mM; Calcium Chloride 5 mM
sample_conditions_1: ionic strength: 0 M; pH: 7; pressure: 1 atm; temperature: 303 K
| Name | Sample | Sample state | Sample conditions |
|---|---|---|---|
| 2D 1H-15N TROSY | sample_1 | isotropic | sample_conditions_1 |
| 3D HNCACB | sample_1 | isotropic | sample_conditions_1 |
| 3D HN(CA)CO | sample_1 | isotropic | sample_conditions_1 |
| 3D 13C-detected N-CO | sample_1 | isotropic | sample_conditions_1 |
| 2D 13C-detected N-CO | sample_1 | isotropic | sample_conditions_1 |
CcpNMR - chemical shift assignment, data analysis
Download HSQC peak lists in one of the following formats:
CSV: Backbone
or all simulated peaks
SPARKY: Backbone
or all simulated peaks