Chem Shift validation: AVS_full
BMRB Entry DOI: doi:10.13018/BMR51782
NMR-STAR file interactive viewer.
NMR-STAR v3 text file.
XML gzip file.
RDF gzip file.
All files associated with the entry
Citation: Theillet, Francois-Xavier. "Structural characterization of Oct4, Sox2, Nanog and Esrrb disordered domains, and a method to identify their phospho-dependent binding partners." C. R. Chim. ., .-..
Assembly members:
entity_1, polymer, 112 residues, Formula weight is not available
Natural source: Common Name: Human Taxonomy ID: 9606 Superkingdom: Eukaryota Kingdom: Metazoa Genus/species: Homo sapiens
Experimental source: Production method: recombinant technology Host organism: Escherichia coli Vector: pet45b(+)
Entity Sequences (FASTA):
entity_1: MAHHHHHHVGTGLNDIFEAQ
KIEWHEGAGMALGSMGSVVK
SEASSSPPVVTSSSHSRAPA
QAGDLRDMISMYLPGAEVPE
PAAPSRLHMSQHYQSGPVPG
TAINGTLPLSHM
| Data type | Count |
| 13C chemical shifts | 294 |
| 15N chemical shifts | 92 |
| 1H chemical shifts | 92 |
| Entity Assembly ID | Entity Name | Entity ID |
|---|---|---|
| 1 | His6-AviTag-Sox2 aa234-317 C265A | 1 |
Entity 1, His6-AviTag-Sox2 aa234-317 C265A 112 residues - Formula weight is not available
MAHHHHHHVGTGLNDIFEAQKIEWHEGA corresponds to His6-AviTag-, GMALGSMGSVVKSEASSSPPVVTSSSHSRAPAQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM corresponds to human Sox2_aa234-317_C265A.
| 1 | MET | ALA | HIS | HIS | HIS | HIS | HIS | HIS | VAL | GLY | ||||
| 2 | THR | GLY | LEU | ASN | ASP | ILE | PHE | GLU | ALA | GLN | ||||
| 3 | LYS | ILE | GLU | TRP | HIS | GLU | GLY | ALA | GLY | MET | ||||
| 4 | ALA | LEU | GLY | SER | MET | GLY | SER | VAL | VAL | LYS | ||||
| 5 | SER | GLU | ALA | SER | SER | SER | PRO | PRO | VAL | VAL | ||||
| 6 | THR | SER | SER | SER | HIS | SER | ARG | ALA | PRO | ALA | ||||
| 7 | GLN | ALA | GLY | ASP | LEU | ARG | ASP | MET | ILE | SER | ||||
| 8 | MET | TYR | LEU | PRO | GLY | ALA | GLU | VAL | PRO | GLU | ||||
| 9 | PRO | ALA | ALA | PRO | SER | ARG | LEU | HIS | MET | SER | ||||
| 10 | GLN | HIS | TYR | GLN | SER | GLY | PRO | VAL | PRO | GLY | ||||
| 11 | THR | ALA | ILE | ASN | GLY | THR | LEU | PRO | LEU | SER | ||||
| 12 | HIS | MET |
sample_1: His6-AviTag-Sox2_aa234-317_C265A, [U-98% 13C; U-98% 15N], 600 ± 100 uM; DSS 0.1 mM; HEPES 20 mM; sodium chloride 50 mM; cocktail protease inhibitors 2 tablet/100mL
sample_conditions_1: ionic strength: 70 mM; pH: 6.8; pressure: 1 atm; temperature: 283 K
| Name | Sample | Sample state | Sample conditions |
|---|---|---|---|
| 1D 1H | sample_1 | isotropic | sample_conditions_1 |
| 2D 1H-15N HSQC | sample_1 | isotropic | sample_conditions_1 |
| 3D HNCO | sample_1 | isotropic | sample_conditions_1 |
| 3D HN(CA)CO | sample_1 | isotropic | sample_conditions_1 |
| 3D HNCACB | sample_1 | isotropic | sample_conditions_1 |
| 3D H(NCA)NH | sample_1 | isotropic | sample_conditions_1 |
TOPSPIN v3 - collection, processing
CcpNMR v2.1 - chemical shift assignment
Download HSQC peak lists in one of the following formats:
CSV: Backbone
or all simulated peaks
SPARKY: Backbone
or all simulated peaks