Chem Shift validation: AVS_full
BMRB Entry DOI: doi:10.13018/BMR51381
NMR-STAR file interactive viewer.
NMR-STAR v3 text file.
XML gzip file.
RDF gzip file.
All files associated with the entry
Citation: Sucec, Iva; Schanda, Paul. "Backbone Chemical Shift Assignments of the cytosolic domain of mitochondrial Tom22 receptor
" .
Assembly members:
entity_1, polymer, 78 residues, Formula weight is not available
Natural source: Common Name: baker's yeast Taxonomy ID: 4932 Superkingdom: Eukaryota Kingdom: Fungi Genus/species: Saccharomyces cerevisiae
Experimental source: Production method: recombinant technology Host organism: Escherichia coli Vector: pET47b-TEV-GB1-His6
Entity Sequences (FASTA):
entity_1: GHMVELTEIKDDVVQLDEPQ
FSRNQAIVEEKASATNNDVV
DDEDDSDSDFEDEFDENETL
LDRIVALKDIVPPGKRLE
| Data type | Count |
| 13C chemical shifts | 194 |
| 15N chemical shifts | 65 |
| 1H chemical shifts | 65 |
| Entity Assembly ID | Entity Name | Entity ID |
|---|---|---|
| 1 | Tom22 | 1 |
Entity 1, Tom22 78 residues - Formula weight is not available
Protein sequence in the assignment project includes two additional residues at the N-ter and 2 at the C-ter, however, the numbering was conserved to match the biological sequence; Tom22(1-74): MVELTEIKDDVVQLDEPQFSRNQAIVEEKASATNNDVVDDEDDSDSDFEDEFDENETLLDRIVALKDIVPPGKR.
| 1 | GLY | HIS | MET | VAL | GLU | LEU | THR | GLU | ILE | LYS | ||||
| 2 | ASP | ASP | VAL | VAL | GLN | LEU | ASP | GLU | PRO | GLN | ||||
| 3 | PHE | SER | ARG | ASN | GLN | ALA | ILE | VAL | GLU | GLU | ||||
| 4 | LYS | ALA | SER | ALA | THR | ASN | ASN | ASP | VAL | VAL | ||||
| 5 | ASP | ASP | GLU | ASP | ASP | SER | ASP | SER | ASP | PHE | ||||
| 6 | GLU | ASP | GLU | PHE | ASP | GLU | ASN | GLU | THR | LEU | ||||
| 7 | LEU | ASP | ARG | ILE | VAL | ALA | LEU | LYS | ASP | ILE | ||||
| 8 | VAL | PRO | PRO | GLY | LYS | ARG | LEU | GLU |
sample_1: Tom22(1-74), [U-99% 13C; U-99% 15N], 0.75 mM; H2O 55.5 M; D2O 10%; potassium phosphate 20 mM
sample_conditions_1: pH: 6; temperature: 300 K
| Name | Sample | Sample state | Sample conditions |
|---|---|---|---|
| 2D 1H-15N TROSY | sample_1 | isotropic | sample_conditions_1 |
| 3D CBCANH | sample_1 | isotropic | sample_conditions_1 |
| 3D CBCA(CO)NH | sample_1 | isotropic | sample_conditions_1 |
| 3D hNcocaNH | sample_1 | isotropic | sample_conditions_1 |
| 3D HNCO | sample_1 | isotropic | sample_conditions_1 |
| 3D HN(CA)CO | sample_1 | isotropic | sample_conditions_1 |
TOPSPIN - collection, processing
CcpNMR v3 - chemical shift assignment, peak picking
CYANA - data analysis
TALOS+ - data analysis
Download HSQC peak lists in one of the following formats:
CSV: Backbone
or all simulated peaks
SPARKY: Backbone
or all simulated peaks