Chem Shift validation: AVS_full, LACS
BMRB Entry DOI: doi:10.13018/BMR25167
NMR-STAR file interactive viewer.
NMR-STAR v3 text file.
XML gzip file.
RDF gzip file.
All files associated with the entry
Citation: Singh, Mahavir; Wang, Zhonghua; Cascio, Duilio; Feigon, Juli. "Structure and interactions of the CS domain of human H/ACA RNP assembly protein Shq1" J. Mol. Biol. 427, 807-823 (2015).
PubMed: 25553844
Assembly members:
Human_Shq1_CS_domain, polymer, 133 residues, Formula weight is not available
Natural source: Common Name: Human Taxonomy ID: 9606 Superkingdom: Eukaryota Kingdom: Metazoa Genus/species: Homo sapiens
Experimental source: Production method: recombinant technology Host organism: Escherichia coli Vector: pET46
Entity Sequences (FASTA):
Human_Shq1_CS_domain: GSTAIGMKETAAAKFERQHM
DSPDLGTGGGSGDDDDKMLT
PAFDLSQDPDFLTIAIRVPY
ARVSEFDVYFEGSDFKFYAK
PYFLRLTLPGRIVENGSEQG
SYDADKGIFTIRLPKETPGQ
HFEGLNMLTALLA
Data type | Count |
13C chemical shifts | 261 |
15N chemical shifts | 86 |
1H chemical shifts | 86 |
Entity Assembly ID | Entity Name | Entity ID |
---|---|---|
1 | Human Shq1 CS domain | 1 |
Entity 1, Human Shq1 CS domain 133 residues - Formula weight is not available
GSTAIGMKETAAAKFERQHMDSPDLGTGGGSGDDDDK (residues -37 to -1) are from the vector after GST tag cleavage
1 | GLY | SER | THR | ALA | ILE | GLY | MET | LYS | GLU | THR | ||||
2 | ALA | ALA | ALA | LYS | PHE | GLU | ARG | GLN | HIS | MET | ||||
3 | ASP | SER | PRO | ASP | LEU | GLY | THR | GLY | GLY | GLY | ||||
4 | SER | GLY | ASP | ASP | ASP | ASP | LYS | MET | LEU | THR | ||||
5 | PRO | ALA | PHE | ASP | LEU | SER | GLN | ASP | PRO | ASP | ||||
6 | PHE | LEU | THR | ILE | ALA | ILE | ARG | VAL | PRO | TYR | ||||
7 | ALA | ARG | VAL | SER | GLU | PHE | ASP | VAL | TYR | PHE | ||||
8 | GLU | GLY | SER | ASP | PHE | LYS | PHE | TYR | ALA | LYS | ||||
9 | PRO | TYR | PHE | LEU | ARG | LEU | THR | LEU | PRO | GLY | ||||
10 | ARG | ILE | VAL | GLU | ASN | GLY | SER | GLU | GLN | GLY | ||||
11 | SER | TYR | ASP | ALA | ASP | LYS | GLY | ILE | PHE | THR | ||||
12 | ILE | ARG | LEU | PRO | LYS | GLU | THR | PRO | GLY | GLN | ||||
13 | HIS | PHE | GLU | GLY | LEU | ASN | MET | LEU | THR | ALA | ||||
14 | LEU | LEU | ALA |
sample_1: Human Shq1 CS domain, [U-100% 15N], 0.2 1.0 mM; sodium phosphate 20 mM; sodium chloride 100 mM; DTT 2 mM; H2O 93%; D2O 7%; sodium azide 0.02%
sample_2: Human Shq1 CS domain, [U-100% 13C; U-100% 15N], 0.2 1.0 mM; sodium phosphate 20 mM; sodium chloride 100 mM; DTT 2 mM; H2O 93%; D2O 7%; sodium azide 0.02%
sample_conditions_1: pH: 7; pressure: 1 atm; temperature: 295 K
Name | Sample | Sample state | Sample conditions |
---|---|---|---|
2D 1H-15N HSQC | sample_1 | isotropic | sample_conditions_1 |
3D CBCA(CO)NH | sample_2 | isotropic | sample_conditions_1 |
3D HNCACB | sample_2 | isotropic | sample_conditions_1 |
3D HNCO | sample_2 | isotropic | sample_conditions_1 |
3D HCACO | sample_2 | isotropic | sample_conditions_1 |
TOPSPIN vBruker, Bruker Biospin - collection, data analysis, processing
SPARKY, Goddard - chemical shift assignment, data analysis, peak picking
BMRB | 19910 |
PDB | |
GB | AAH17204 AAH17274 AAH25270 AAH32671 AAH39830 |
REF | NP_060600 XP_001082636 XP_001141951 XP_001493794 XP_003132372 |
SP | Q6PI26 |
AlphaFold | Q6PI26 |
Download HSQC peak lists in one of the following formats:
CSV: Backbone
or all simulated peaks
SPARKY: Backbone
or all simulated peaks