Click here to enlarge.
PDB ID:
Entry in NMR Restraints Grid
Validation report in NRG-CING
Chem Shift validation: AVS_full
BMRB Entry DOI: doi:10.13018/BMR26889
MolProbity Validation Chart
NMR-STAR file interactive viewer.
NMR-STAR v3 text file.
XML gzip file.
RDF gzip file.
All files associated with the entry
Citation: Zgadzay, Yuriy; Efimov, Sergey; Klochkov, Vladimir. "Spectroscopic and Structural Data for Bovine Insulin obtained by NMR" .
Assembly members:
bovine_insulin, polymer, 51 residues, Formula weight is not available
Natural source: Common Name: cow Taxonomy ID: 9913 Superkingdom: Eukaryota Kingdom: Metazoa Genus/species: Bos taurus
Experimental source: Production method: obtained from a vendor Host organism: Bos taurus
Entity Sequences (FASTA):
bovine_insulin: GIVEQCCASVCSLYQLENYC
NFVNQHLCGSHLVEALYLVC
GERGFFYTPKA
| Data type | Count |
| 13C chemical shifts | 179 |
| 1H chemical shifts | 359 |
| Entity Assembly ID | Entity Name | Entity ID |
|---|---|---|
| 1 | bovine insulin, chain A and B | 1 |
Entity 1, bovine insulin, chain A and B 51 residues - Formula weight is not available
Chain A: GIVEQCCASVCSLYQLENYCN Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKA
| 1 | GLY | ILE | VAL | GLU | GLN | CYS | CYS | ALA | SER | VAL | ||||
| 2 | CYS | SER | LEU | TYR | GLN | LEU | GLU | ASN | TYR | CYS | ||||
| 3 | ASN | PHE | VAL | ASN | GLN | HIS | LEU | CYS | GLY | SER | ||||
| 4 | HIS | LEU | VAL | GLU | ALA | LEU | TYR | LEU | VAL | CYS | ||||
| 5 | GLY | GLU | ARG | GLY | PHE | PHE | TYR | THR | PRO | LYS | ||||
| 6 | ALA |
sample_1: bovine insulin 1.1 mM
sample_conditions_1: pH: 2.86; pressure: 1 atm; temperature: 293 K
| Name | Sample | Sample state | Sample conditions |
|---|---|---|---|
| 2D 1H-1H TOCSY | sample_1 | isotropic | sample_conditions_1 |
| 2D 1H-1H NOESY | sample_1 | isotropic | sample_conditions_1 |
| 2D DQF-COSY | sample_1 | isotropic | sample_conditions_1 |
| 2D 1H-13C HSQC | sample_1 | isotropic | sample_conditions_1 |
NMRPipe, Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax - processing
SPARKY, Goddard - chemical shift assignment, peak picking
TOPSPIN v3.2, Bruker Biospin - collection